Üsküdar Belediyesi

Üsküdar belediyesi ile çalışmanın gururunu yaşıyoruz

Birikim Eğitim Kurumları !

Bizim sayemizde kazalardan korunun...

Kazalardan Korunun !

Bizim sayemizde kazalardan korunun...

Firmanıza değer katın !

Uzmanlarımızın risk değerlendirmeleri sayesinde firmanıza değer katın.

Kazalardan Korunun !

Bizim sayemizde kazalardan korunun...

Tehlike Sınıfınızı Öğrenin


NACEKodu Tanım Tehlike Sınıfı
A TARIM, ORMANCILIK VEBALIKÇILIK
01 Bitkisel ve hayvansal üretimile avcılık ve ilgili hizmetfaaliyetleri
01.1 Tek yıllık (uzun ömürlüolmayan) bitkisel ürünlerinyetiştirilmesi
01.11 Tahılların (pirinç hariç),baklagillerin ve yağlı tohumlarınyetiştirilmesi
01.11.07 Baklagillerin yetiştirilmesi(fasulye (taze ve kuru), bakla,nohut, mercimek, acı bakla,bezelye, araka vb.) Tehlikeli
01.11.12 Tahıl yetiştiriciliği (buğday,dane mısır, süpürge darısı, arpa,çavdar, yulaf, darı, kuş yemi vb.)(pirinç hariç) Tehlikeli
01.11.14 Yağlı tohum yetiştiriciliği(soya fasulyesi, yer fıstığı, pamukçekirdeği, kene otu çekirdeği (Hintyağı çekirdeği), keten tohumu,hardal tohumu, nijer tohumu, kolza,aspir tohumu, susam tohumu,ayçiçeği tohumu vb.) Tehlikeli
01.12 Çeltik (kabuklu pirinç)yetiştirilmesi
01.12.14 Çeltik (kabuklu pirinç)yetiştirilmesi Tehlikeli
01.13 Sebze, kavun-karpuz, kök veyumru sebzelerinyetiştirilmesi
01.13.17 Şeker pancarıyetiştirilmesi Tehlikeli
01.13.18 Yenilebilir kök ve yumrularınyetiştiriciliği (patates, tatlıpatates, manyok, Hint yer elması,vb.) Tehlikeli
01.13.19 Diğer sebze tohumlarınınyetiştiriciliği (şeker pancarıtohumu dahil, diğer pancartohumları hariç) Tehlikeli
01.13.20 Meyvesi yenen sebzelerinyetiştirilmesi (hıyar, kornişon,sivri ve dolmalık biber, kavun,karpuz, kabakgil türleri, domates,biber, patlıcan vb.) Tehlikeli
01.13.21 Mantar ve yer mantarları(domalan) yetiştirilmesi Tehlikeli
01.13.22 Kökleri, soğanları, yumrularıtüketilen sebzelerin yetiştirilmesi(havuç, şalgam, sarımsak, soğan,arpacık soğan, pırasa ve diğerbenzer sebzeler) Tehlikeli
01.13.23 Yapraklı veya saplı sebzelerinyetiştirilmesi (enginar, kuşkonmaz,lahana, karnabahar ve brokoli,marul ve hindiba, ıspanak vb.) Tehlikeli
01.14 Şeker kamışıyetiştirilmesi
01.14.01 Şeker kamışıyetiştirilmesi Tehlikeli
01.15 Tütün yetiştirilmesi
01.15.01 Tütün yetiştiriciliği Tehlikeli
01.16 Lifli bitkilerinyetiştirilmesi
01.16.02 Pamuk yetiştiriciliği Tehlikeli
01.16.90 Diğer lifli bitkilerinyetiştirilmesi (keten, kenevir, jütvs.) Tehlikeli
01.19 Tek yıllık (uzun ömürlüolmayan) diğer bitkisel ürünlerinyetiştirilmesi
01.19.01 Hayvan yemi bitkilerininyetiştiriciliği (sarı şalgam,mangoldlar, yemlik kökleri, yonca,korunga, yemlik mısır ve diğerotlar ile bunların tohumları vepancar tohumları dahil, şekerpancarı tohumları hariç) Tehlikeli
01.19.02 Çiçek yetiştiriciliği (lale,kasımpatı, zambak, gül vb. ilebunların tohumları) Tehlikeli
01.19.90 Başka yerde sınıflandırılmamıştek yıllık diğer bitkisel ürünlerinyetiştirilmesi Tehlikeli
01.2 Çok yıllık (uzun ömürlü)bitkisel ürünlerinyetiştirilmesi
01.21 Üzüm yetiştirilmesi
01.21.05 Üzüm yetiştiriciliği (şaraplık,sofralık ve diğer üzümler) Tehlikeli
01.22 Tropikal ve subtropikalmeyvelerin yetiştirilmesi
01.22.05 Tropikal ve subtropikalmeyvelerin yetiştiriciliği (muz,hurma, incir, avokado, mangovb.) Tehlikeli
01.23 Turunçgillerinyetiştirilmesi
01.23.02 Turunçgillerin yetiştirilmesi(greyfurt, limon, misket limonu,portakal, mandalina vb.) Tehlikeli
01.24 Yumuşak çekirdekli meyvelerinve sert çekirdekli meyvelerinyetiştirilmesi
01.24.04 Yumuşak veya sert çekirdeklimeyvelerin yetiştirilmesi (elma,kayısı, kiraz, ayva, erik vb.)(turunçgiller ve üzüm hariç) Tehlikeli
01.25 Diğer ağaç ve çalı meyvelerininve sert kabuklu meyvelerinyetiştirilmesi
01.25.08 Diğer ağaç ve çalı (çok yıllıkbitkilerin) meyvelerinin ve sertkabuklu meyvelerin (yaban mersini,kuş üzümü, kestane, fıstık, çilek,ahududu, ceviz, keçiboynuzu vb.(fındık hariç)) yetiştirilmesi Tehlikeli
01.25.09 Fındık yetiştiriciliği Tehlikeli
01.26 Yağlı meyvelerinyetiştirilmesi
01.26.02 Zeytin yetiştiriciliği Tehlikeli
01.26.90 Diğer yağlı meyvelerinyetiştiriciliği (Hindistan cevizi,hurma palmiyeleri vb.) (zeytinhariç) Tehlikeli
01.27 İçecek üretiminde kullanılanbitkisel ürünlerinyetiştirilmesi
01.27.02 Çay yetiştiriciliği (siyah çay,yeşil çay, Paraguay çayı vb.) Tehlikeli
01.27.90 İçecek üretiminde kullanılandiğer bitkisel ürünlerinyetiştiriciliği (kahve, kakao, vb.)(çay yetiştiriciliği hariç) Tehlikeli
01.28 Baharatlık, aromatik (ıtırlı),uyuşturucu nitelikte ve eczacılıklailgili bitkisel ürünlerinyetiştirilmesi
01.28.01 Baharatlık, aromatik (ıtırlı),uyuşturucu nitelikte ve eczacılıklailgili bitkisel ürünlerin (anason,muskat, tarçın, karanfil, zencefil,vanilya, beyaz veya kara biber,ıhlamur, adaçayı vb.)yetiştirilmesi Tehlikeli
01.29 Diğer çok yıllık (uzun ömürlü)bitkisel ürünlerinyetiştirilmesi
01.29.01 Kauçuk ağacı, yılbaşı ağacı,örgü, dolgu ve tabaklama yapmakiçin kullanılan bitkisel ürünlervb. uzun ömürlü bitkisel ürünlerinyetiştirilmesi Tehlikeli
01.3 Dikim için bitkiyetiştirilmesi
01.30 Dikim için bitkiyetiştirilmesi
01.30.03 Dikim için sebze fidesi, meyvefidanı vb. yetiştirilmesi Az Tehlikeli
01.30.04 Dikim için çiçek ve diğerbitkilerin yetiştirilmesi(dekoratif amaçlarla bitki ve çimyetiştirilmesi dahil, sebze fidesi,meyve fidanı hariç) Az Tehlikeli
01.4 Hayvansal üretim
01.41 Sütü sağılan büyük baş hayvanyetiştiriciliği
01.41.31 Sütü sağılan büyük baş hayvanyetiştiriciliği (sütü için inek vemanda yetiştiriciliği) Tehlikeli
01.42 Diğer sığır ve mandayetiştiriciliği
01.42.09 Diğer sığır ve mandayetiştiriciliği (sütü içinyetiştirilenler hariç) Tehlikeli
01.43 At ve at benzeri diğer hayvanyetiştiriciliği
01.43.01 At ve at benzeri diğer hayvanyetiştiriciliği (eşek, katır veyabardo vb.) Tehlikeli
01.44 Deve ve devegillerinyetiştiriciliği
01.44.01 Deve yetiştiriciliği Tehlikeli
01.45 Koyun ve keçiyetiştiriciliği
01.45.01 Koyun ve keçi (davar)yetiştiriciliği (işlenmemiş süt,kıl, tiftik, yapağı, yün vb.üretimi dahil) Tehlikeli
01.46 Domuz yetiştiriciliği
01.46.01 Domuz yetiştiriciliği Tehlikeli
01.47 Kümes hayvanlarıyetiştiriciliği
01.47.01 Kümes hayvanlarınınyetiştirilmesi (tavuk, hindi,ördek, kaz ve beç tavuğu vb.) Tehlikeli
01.47.02 Kuluçkahanelerinfaaliyetleri Tehlikeli
01.47.03 Kümes hayvanlarından yumurtaüretilmesi Tehlikeli
01.49 Diğer hayvanyetiştiriciliği
01.49.01 Arıcılık, bal ve bal mumuüretilmesi (arı sütü dahil) Tehlikeli
01.49.02 İpekböceği yetiştiriciliği vekoza üretimi Tehlikeli
01.49.03 Evcil hayvanlarınyetiştirilmesi ve üretilmesi (balıkhariç) (kedi, köpek, kuşlar,hamsterler vb.) Tehlikeli
01.49.05 Deve kuşlarınınyetiştirilmesi Tehlikeli
01.49.90 Yarı evcilleştirilmiş veyadiğer canlı hayvanlarınyetiştirilmesi ve üretilmesi (diğerkuşlar (kümes hayvanları hariç),böcekler, tavşanlar ve diğer kürkhayvanları, salyangoz, solucançiftlikleri, sürüngen çiftlikleri,hayvan embriyosu vb.) Tehlikeli
01.5 Karma çiftçilik
01.50 Karma çiftçilik
01.50.06 Karma çiftçilik (bitkisel veyahayvansal üretim konusundauzmanlaşma olmaksızın üretim) Tehlikeli
01.6 Tarımı destekleyici faaliyetlerve hasat sonrası bitkisel ürünlerile ilgili faaliyetler
01.61 Bitkisel üretimi destekleyicifaaliyetler
01.61.01 Bitkisel üretimi destekleyicigübreleme, tarlanın sürülmesi,ekilmesi, çapalama ile meyvecilikleilgili budama vb. faaliyetler(çiçek yetiştiriciliğinidestekleyici faaliyetler ile havayoluyla yapılan gübrelemehariç) Tehlikeli
01.61.02 Bitkisel üretimi destekleyicimahsulün hasat ve harmanlanması,biçilmesi, balyalanması, biçerdöverişletilmesi vb. faaliyetler Tehlikeli
01.61.03 Bitkisel üretimi destekleyicitarımsal amaçlı sulamafaaliyetleri Tehlikeli
01.61.04 Bitkisel üretimi destekleyiciilaçlama ve zirai mücadelefaaliyetleri (zararlı otlarınimhası dahil, hava yoluylayapılanlar hariç) Çok Tehlikeli
01.61.05 Çiçek yetiştiriciliğinidestekleyici gübreleme, tarlanınsürülmesi, ekilmesi, bakımı,toplama vb. ile ilgili faaliyetler(hava yoluyla yapılan gübrelemehariç) Tehlikeli
01.61.06 Hava yoluyla yapılan bitkiselüretimi destekleyici gübreleme,ilaçlama ve zirai mücadelefaaliyetleri (zararlı otlarınimhası dahil) Çok Tehlikeli
01.62 Hayvan üretimini destekleyicifaaliyetler
01.62.01 Hayvan üretimini destekleyiciolarak sürülerin güdülmesi,başkalarına ait hayvanlarınbeslenmesi, kümeslerintemizlenmesi, kırkma, sağma,barınak sağlama, nalbantlık vb.faaliyetler Tehlikeli
01.62.02 Hayvan üretimini destekleyiciolarak sürü testi, kümeshayvanlarının kısırlaştırılması,yapay dölleme, vb. faaliyetler(kuluçkahanelerdeki faaliyetlerdahil) Tehlikeli
01.63 Hasat sonrası bitkisel ürünlerile ilgili faaliyetler
01.63.01 Hasat sonrası diğer ürünlerinayıklanması ve temizlenmesi ileilgili faaliyetler (pamuğunçırçırlanması ve nişastalı kökürünleri hariç) Tehlikeli
01.63.02 Sert kabuklu ürünlerinkabuklarının kırılması vetemizlenmesi ile ilgilifaaliyetler Tehlikeli
01.63.03 Haşhaş vb. ürünlerin sürtme,ezme ve temizlenmesi ile ilgilifaaliyetler Tehlikeli
01.63.04 Mısır vb. ürünlerin tanelenmesive temizlenmesi ile ilgilifaaliyetler Tehlikeli
01.63.05 Tütünün sınıflandırılması,balyalanması vb. hizmetler Az Tehlikeli
01.63.06 Nişastalı kök ürünlerininayıklanması ve temizlenmesi(patates vb.) Tehlikeli
01.63.07 Çırçırlama faaliyeti Tehlikeli
01.63.90 Hasat sonrası bitkisel ürünlerile ilgili diğer faaliyetler Tehlikeli
01.64 Bitkisel üretim için tohumunişlenmesi
01.64.01 Üretim amaçlı tohum işlemehizmetleri (vernelizasyon işlemleridahil) Tehlikeli
01.7 Avcılık, tuzakla avlanma veilgili hizmet faaliyetleri
01.70 Avcılık, tuzakla avlanma veilgili hizmet faaliyetleri
01.70.01 Ticari olmayan av hayvanı veyabani hayvan avlama ve yakalamafaaliyetleri (yenilmesi, kürkleri,derileri, araştırmalardakullanılmaları vb. amaçlar için)(balıkçılık hariç) Tehlikeli
01.70.02 Ticari olan av hayvanı veyabani hayvan avlama ve yakalamafaaliyetleri (yenilmesi, kürkleri,derileri, araştırmalardakullanılmaları vb. amaçlar için)(balıkçılık hariç) Tehlikeli
02 Ormancılık ile endüstriyel veyakacak odun üretimi
02.1 Orman yetiştirme (Silvikültür)ve diğer ormancılıkfaaliyetleri
02.10 Orman yetiştirme (Silvikültür)ve diğer ormancılıkfaaliyetleri
02.10.01 Baltalık olarak işletilenormanların yetiştirilmesi (kağıtlıkve yakacak odun üretimine yönelikolanlar dahil) Tehlikeli
02.10.02 Orman yetiştirmek için fidan vetohum üretimi Az Tehlikeli
02.10.03 Orman ağaçlarınınyetiştirilmesi (baltalık ormanlarınyetiştirilmesi hariç) Az Tehlikeli
02.2 Endüstriyel ve yakacak odunüretimi
02.20 Endüstriyel ve yakacak odunüretimi
02.20.01 Endüstriyel ve yakacak odunüretimi (geleneksel yöntemlerleodun kömürü üretimi dahil) Tehlikeli
02.3 Tabii olarak yetişen odun dışıorman ürünlerinin toplanması
02.30 Tabii olarak yetişen odun dışıorman ürünlerinin toplanması
02.30.01 Ağaç dışındaki yabani olarakyetişen ürünlerinin toplanması(mantar meşesinin kabuğu, kök,kozalak, balsam, lak ve reçine,meşe palamudu, at kestanesi, yosunve likenler, yabani çiçek, yabanimeyve, yenilebilir mantar vb.) Az Tehlikeli
02.4 Ormancılık için destekleyicifaaliyetler
02.40 Ormancılık için destekleyicifaaliyetler
02.40.01 Ormanda ağaçların kesilmesi,dallarından temizlenmesi, soyulmasıvb. destekleyici faaliyetler Tehlikeli
02.40.02 Ormanda kesilmiş ve temizlenmişağaçların taşınması, istiflenmesive yüklenmesi faaliyetleri Tehlikeli
02.40.03 Ormanda silvikültürel hizmetfaaliyetleri (seyreltilmesi,budanması, repikaj vb.) Tehlikeli
02.40.04 Ormanı zararlılara (böcek vehastalıklar) karşı korumafaaliyetleri Çok Tehlikeli
02.40.05 Ormanı yangın ve kaçak kesime(izinsiz kesim) karşı korumafaaliyetleri Tehlikeli
02.40.06 Ormanı koruma ve bakımı amaçlıorman yolu yapımı ve bakımıfaaliyetleri Tehlikeli
02.40.07 Diğer ormancılık hizmetfaaliyetleri (ormancılıkenvanterleri, orman işletmesi,orman idaresi danışmanlıkhizmetleri, orman (bakımı, verimi,vb.) ile ilgili araştırmageliştirme, vb.) Az Tehlikeli
03 Balıkçılık ve su ürünleriyetiştiriciliği
03.1 Balıkçılık
03.11 Deniz balıkçılığı
03.11.01 Deniz ve kıyı sularında yapılanbalıkçılık (gırgır balıkçılığı,dalyancılık dahil) Tehlikeli
03.11.02 Deniz kabuklularının (midye,ıstakoz vb.), yumuşakçaların, diğerdeniz canlıları ve ürünlerinintoplanması (sedef, doğal inci,sünger, mercan, deniz yosunu,vb.) Çok Tehlikeli
03.12 Tatlı su balıkçılığı
03.12.01 Tatlı sularda (ırmak, göl)yapılan balıkçılık (alabalık,sazan, yayın vb.) Tehlikeli
03.2 Su ürünleriyetiştiriciliği
03.21 Deniz ürünleriyetiştiriciliği
03.21.01 Denizde yapılan balıkyetiştiriciliği (çipura, karagöz,kefal vb. yetiştiriciliği ilekültür balığı, balık yumurtası veyavrusu dahil) Tehlikeli
03.21.02 Denizde yapılan diğer suürünleri yetiştiriciliği (midye,istiridye, ıstakoz, karides,eklembacaklılar, kabuklular, denizyosunları vb.) (balık hariç) Tehlikeli
03.22 Tatlı su ürünleriyetiştiriciliği
03.22.01 Tatlı sularda yapılan balıkyetiştiriciliği (süs balığı, kültürbalığı, balık yumurtası ve yavrusudahil) Tehlikeli
03.22.02 Tatlısu ürünleriyetiştiriciliği (yumuşakçalar,kabuklular, kurbağalar vb.) (balıkhariç) Tehlikeli
B MADENCİLİK VE TAŞOCAKÇILIĞI
05 Kömür ve linyitçıkartılması
05.1 Taş kömürü madenciliği
05.10 Taş kömürü madenciliği
05.10.01 Taş kömürü madenciliği Çok Tehlikeli
05.2 Linyit madenciliği
05.20 Linyit madenciliği
05.20.01 Linyit madenciliği Çok Tehlikeli
06td> Ham petrol ve doğal gazçıkarımı
06.1 Ham petrol çıkarımı
06.10 Ham petrol çıkarımı
06.10.01 Ham petrolün çıkarılması Çok Tehlikeli
06.2 Doğal gaz çıkarımı
06.20 Doğal gaz çıkarımı
06.20.01 Doğalgaz çıkarılması(madenciliği) Çok Tehlikeli
07 Metal cevherlerimadenciliği
07.1 Demir cevherlerimadenciliği
07.10 Demir cevherlerimadenciliği
07.10.01 Demir cevheri madenciliği(sinterlenmiş demir cevheri üretimidahil) Çok Tehlikeli
07.2 Demir dışı metal cevherlerimadenciliği
07.21 Uranyum ve toryum cevherlerimadenciliği
07.21.01 Katran ve zift ihtiva edencevherlerden uranyum metalininayrıştırılması Çok Tehlikeli
07.21.02 Katran ve zift ihtiva edencevherlerden toryum metalininayrıştırılması Çok Tehlikeli
07.21.03 Uranyum madenciliği Çok Tehlikeli
07.21.04 Toryum madenciliği Çok Tehlikeli
07.21.05 Sarı pasta (U3O8) imalatı(uranyum cevherinden eldeedilen) Çok Tehlikeli
07.29 Diğer demir dışı metalcevherleri madenciliği
07.29.01 Altın, gümüş, platin gibideğerli metal madenciliği Çok Tehlikeli
07.29.02 Alüminyum madenciliği Çok Tehlikeli
07.29.03 Bakır madenciliği Çok Tehlikeli
07.29.04 Nikel madenciliği Çok Tehlikeli
07.29.05 Kurşun, çinko ve kalaymadenciliği Çok Tehlikeli
07.29.06 Krom madenciliği Çok Tehlikeli
07.29.07 Başka yerde sınıflandırılmamışdemir dışı diğer metal cevherlerimadenciliği (cıva, manganez,kobalt, molibden, tantal, vanadyumvb.) (değerli metaller, demir,bakır, kurşun, çinko, alüminyum,kalay, krom, nikel hariç) Çok Tehlikeli
08 Diğer madencilik ve taşocakçılığı
08.1 Kum, kil ve taş ocakçılığı
08.11 Süsleme ve yapı taşları ilekireç taşı, alçı taşı, tebeşir vekayağantaşı (arduvaz-kayraktaşı)ocakçılığı
08.11.01 Mermer ocakçılığı (travertendahil) Çok Tehlikeli
08.11.02 Granit ocakçılığı Çok Tehlikeli
08.11.03 Yapı taşları ocakçılığı Çok Tehlikeli
08.11.04 Süsleme ve yapı taşlarınınkırılması ve kabaca kesilmesi Çok Tehlikeli
08.11.05 Dolomit ve kayağan taşı(arduvaz / kayraktaşı)ocakçılığı Çok Tehlikeli
08.11.06 Kireçtaşı (kalker) ocakçılığı(kireçtaşının kırılması veparçalanması dahil) Çok Tehlikeli
08.11.07 Tebeşir, alçıtaşı ve anhidritocakçılığı (çıkarma, parçalama,pişirme işlemi dahil) Çok Tehlikeli
08.12 Çakıl ve kum ocaklarınınfaaliyetleri; kil ve kaolinçıkarımı
08.12.01 Çakıl ve kum ocakçılığı(taşların kırılması ile kil vekaolin madenciliği hariç) Çok Tehlikeli
08.12.02 Çakıl taşlarının kırılması veparçalanması Çok Tehlikeli
08.12.03 Kil, refrakter kil ve kaolinmadenciliği ile bentonit,andaluzit, siyanit, silimanit,mulit, şamot veya dinas topraklarıçıkarımı Çok Tehlikeli
08.9 Başka yerde sınıflandırılmamışmadencilik ve taş ocakçılığı
08.91 Kimyasal ve gübreleme amaçlımineral madenciliği
08.91.01 Kimyasal ve gübreleme amaçlımineral madenciliği (azot,potasyum, fosfor, fosfat, nitrat,barit, baryum, pirit, vb.) (bor,kükürt madenciliği hariç) Çok Tehlikeli
08.91.02 Bor minerallerimadenciliği Çok Tehlikeli
08.91.03 Kükürt madenciliği(ocakçılığı) Çok Tehlikeli
08.91.04 Guano madenciliği (kuş gübresi,güherçile dahil) Çok Tehlikeli
08.91.05 Kehribar, Oltu taşı ve lületaşıocakçılığı Çok Tehlikeli
08.92 Turba çıkarımı
08.92.01 Turba çıkarılması vetoplanması Çok Tehlikeli
08.93 Tuz çıkarımı
08.93.01 Tuz ocakçılığı (deniz, göl,kaya, kaynak), tuzun elenmesi vekırılması dahil Çok Tehlikeli
08.99 Başka yerde sınıflandırılmamışdiğer madencilik ve taşocakçılığı
08.99.01 Aşındırıcı (törpüleyici)materyaller (zımpara), amyant,silisli fosil artıklar, arsenikcevherleri, sabuntaşı (talk) vefeldispat madenciliği (kuartz,mika, şist, talk, silis, süngertaşı, asbest, doğal korindonvb.) Çok Tehlikeli *
08.99.02 Doğal asfalt, asfaltit,asfaltlı taş (doğal katı zift) vebitüm madenciliği Çok Tehlikeli
08.99.03 Kıymetli ve yarı kıymetlitaşların (yakut, zümrüt, safir,kalsedon vb.) ocakçılığı (kehribar,Oltu taşı, lüle taşı ve elmashariç) Çok Tehlikeli
08.99.04 Grafit ocakçılığı Çok Tehlikeli
08.99.05 Elmas (endüstri elmaslarıdahil) madenciliği Çok Tehlikeli
08.99.90 Başka yerde sınıflandırılmamışdiğer madencilik vetaşocakçılığı Çok Tehlikeli
09 Madenciliği destekleyici hizmetfaaliyetleri
09.1 Petrol ve doğal gaz çıkarımınıdestekleyici faaliyetler
09.10 Petrol ve doğal gaz çıkarımınıdestekleyici faaliyetler
09.10.01 Doğalgazın sıvılaştırılması vegaz haline getirilmesi (madenalanında gerçekleştirilenler) Çok Tehlikeli
09.10.02 Petrol ve gaz çıkarımıylailgili sondaj hizmetleri (tetkik,araştırma hizmetleri, jeolojikgözlemler, kuyu çalıştırılması vekapatılması ile test amaçlı sondajfaaliyetleri vb. dahil) Çok Tehlikeli
09.10.03 Petrol ve gaz çıkarımı ileilgili vinç ve sondaj kulesi kurma,onarım, sökme vb. hizmetfaaliyetleri Çok Tehlikeli
09.9 Madencilik ve taş ocakçılığınıdestekleyici diğer faaliyetler
09.90 Madencilik ve taş ocakçılığınıdestekleyici diğer faaliyetler
09.90.01 Madencilik ve taş ocakçılığınıdestekleyici diğer hizmetfaaliyetleri (tetkik, araştırmahizmetleri, jeolojik gözlemler,boşaltma, pompalama hizmetleri)(test amaçlı sondaj faaliyetleriile petrol ve doğalgaz içinyapılanlar hariç) Tehlikeli
09.90.02 Madencilik ve taş ocakçılığınıdestekleyici test amaçlı sondajfaaliyetleri (petrol ve doğalgaziçin yapılanlar hariç) Çok Tehlikeli
C İMALAT
10 Gıda ürünlerinin imalatı
10.1 Etin işlenmesi ve saklanmasıile et ürünlerinin imalatı
10.11 Etin işlenmesi vesaklanması
10.11.01 Sığır, koyun, keçi vb.hayvanların kesimi ve kesimsırasındaki etin işlenmesi(mezbahacılık) (taze, soğutulmuşveya dondurulmuş olarak saklanmasıdahil) Tehlikeli
10.12 Kümes hayvanları etlerininişlenmesi ve saklanması
10.12.01 Kümes hayvanları etlerininüretimi (taze veya dondurulmuş)(yenilebilir sakatatlarıdahil) Tehlikeli
10.12.02 Kümes hayvanlarının kesilmesi,temizlenmesi veya paketlenmesi işiile uğraşan mezbahalarınfaaliyetleri Tehlikeli
10.12.03 Kümes hayvanlarının yağlarınınsofra yağına çevrilmesi Tehlikeli
10.12.04 Kuş tüyü ve ince kuş tüyüimalatı (derileri dahil) Tehlikeli
10.13 Et ve kümes hayvanlarıetlerinden üretilen ürünlerinimalatı
10.13.01 Et ve kümes hayvanlarıetlerinden üretilen pişmemiş köftevb. ürünlerin imalatı Tehlikeli
10.13.02 Et ve kümes hayvanlarıetlerinden üretilen sosis, salam,sucuk, pastırma, kavurma et,konserve et, salamura et, jambonvb. tuzlanmış, kurutulmuş veyatütsülenmiş ürünlerin imalatı(yemek olanlar hariç) Tehlikeli
10.13.03 Et ve sakatat unları imalatı(et ve kümes hayvanları etlerindenüretilen) Tehlikeli
10.13.04 Sığır, koyun, keçi vb.hayvanların sakatat ve yağlarındanyenilebilir ürünlerin imalatı Tehlikeli
10.2 Balık, kabuklu deniz hayvanlarıve yumuşakçaların işlenmesi vesaklanması
10.20 Balık, kabuklu deniz hayvanlarıve yumuşakçaların işlenmesi vesaklanması
10.20.03 Balıkların, kabuklu denizhayvanlarının ve yumuşakçalarınişlenmesi ve saklanması(dondurulması, kurutulması,pişirilmesi, tütsülenmesi,tuzlanması, salamura edilmesi,konservelenmesi vb.faaliyetler) Tehlikeli
10.20.04 Balık, kabuklu deniz hayvanı veyumuşakça ürünlerinin üretimi(balık filetosu, balık yumurtası,havyar, havyar yerine kullanılanürünler vb.) Tehlikeli
10.20.05 Balık unları, kaba unları vepeletlerinin üretilmesi (insantüketimi için) Tehlikeli
10.20.06 Balığın sadece işlenmesi vesaklanmasıyla ilgili faaliyetgösteren tekne ve gemilerinfaaliyetleri Tehlikeli
10.20.07 Pişirilmemiş balık yemekleriimalatı (mayalanmış balık, balıkhamuru, balık köftesi vb.) Tehlikeli
10.20.08 Balıkların, kabukluların,yumuşakçaların veya diğer suomurgasızlarının unları, kabaunları ve peletlerinin üretimi(insan tüketimine uygun olmayan)ile bunların diğer yenilemeyenürünlerinin üretimi Tehlikeli
10.3 Sebze ve meyvelerin işlenmesive saklanması
10.31 Patatesin işlenmesi vesaklanması
10.31.01 Patatesin işlenmesi vesaklanması (dondurulmuş,kurutulmuş, suyu çıkartılmış,ezilmiş patates imalatı) (soyulmasıdahil) Tehlikeli
10.31.02 Patates cipsi, patates çerezi,patates unu ve kaba unlarınınimalatı Tehlikeli
10.32 Sebze ve meyve suyuimalatı
10.32.01 Katkısız sebze ve meyve sularıimalatı (şalgam suyu, domates suyu,havuç suyu, portakal suyu, elmasuyu, kayısı suyu vb.) Az Tehlikeli
10.32.02 Konsantre meyve ve sebze suyuimalatı Az Tehlikeli
10.39 Başka yerde sınıflandırılmamışmeyve ve sebzelerin işlenmesi vesaklanması
10.39.01 Sebze ve meyve konservesiimalatı (salça, domates püresidahil, patatesten olanlarhariç) Tehlikeli
10.39.02 Kavrulmuş, tuzlanmış vb.şekilde işlem görmüş sert kabukluyemişler ile bu meyvelerin püre veezmelerinin imalatı (pişirilerekyapılanlar) Az Tehlikeli
10.39.03 Meyve ve sebzelerden jöle,pekmez, marmelat, reçel vb. imalatı(pestil imalatı dahil) Az Tehlikeli
10.39.04 Tuzlu su, sirke, sirkeli su,yağ veya diğer koruyucuçözeltilerle korunarak saklanansebze ve meyvelerin imalatı (turşu,salamura yaprak, sofralık zeytinvb. dahil) Az Tehlikeli
10.39.05 Dondurulmuş veya kurutulmuşmeyve ve sebzelerin imalatı (kurukayısı, kuru üzüm, kuru bamya, kurubiber vb.) Az Tehlikeli
10.39.06 Leblebi imalatı ile kavrulmuşçekirdek, yerfıstığı vb. üretimi(sert kabuklular hariç) Az Tehlikeli
10.39.07 Susamın işlenmesi ve tahinimalatı Tehlikeli
10.39.90 Başka yerde sınıflandırılmamışmeyve ve sebzelerin başkayöntemlerle işlenmesi ve saklanması(kesilmiş ve paketlenmiş olanlardahil) Az Tehlikeli
10.4 Bitkisel ve hayvansal sıvı vekatı yağların imalatı
10.41 Sıvı ve katı yağ imalatı
10.41.01 Ayçiçek yağı imalatı Tehlikeli
10.41.02 Bitkisel sıvı yağ (yenilebilen)imalatı (soya, susam, haşhaş,pamuk, fındık, kolza, hardal vb.yağlar) (zeytin yağı, ayçiçeği yağıve mısır yağı hariç) Tehlikeli
10.41.03 Beziryağı imalatı Tehlikeli
10.41.05 Prina yağı imalatı (diğerküspelerden elde edilen yağlardahil) (mısır yağı hariç) Tehlikeli
10.41.06 Kakao yağı, badem yağı, kekikyağı, defne yağı, hurma çekirdeğiveya babassu yağı, keten tohumuyağı, Hint yağı, tung yağı ve diğerbenzer yağların imalatı (bezir yağıhariç) Tehlikeli
10.41.07 Zeytinyağı imalatı (saf, sızma,rafine) Tehlikeli
10.41.10 Balık ve deniz memelilerindenyağ elde edilmesi Tehlikeli
10.41.11 Domuz don yağı (stearin), domuzsıvı yağı, oleostarin, oleoil veyenilemeyen sıvı don yağı (tallowoil) ile diğer hayvansal katı vesıvı yağların imalatı(işlenmemiş) Tehlikelitd>
10.42 Margarin ve benzeri yenilebilirkatı yağların imalatı
10.42.01 Margarin, karışık yemeklik vesofralık katı yağların imalatı Tehlikeli
10.5 Süt ürünleri imalatı
10.51 Süthane işletmeciliği ve peynirimalatı
10.51.01 Süt imalatı, işlenmiş(pastörize edilmiş, sterilizeedilmiş, homojenleştirilmiş ve/veyayüksek ısıdan geçirilmiş) (katıveya toz halde süt hariç) Tehlikeli
10.51.02 Peynir, lor ve çökelekimalatı Tehlikeli
10.51.03 Süt tozu, peynir özü (kazein),süt şekeri (laktoz) ve peynir altısuyu (kesilmiş sütün suyu) imalatı(katı veya toz halde süt, kremadahil) Az Tehlikeli
10.51.04 Süt temelli hafif içeceklerinimalatı (kefir, salep vb.) Az Tehlikeli
10.51.05 Sütten yapılan diğer ürünlerinimalatı (tereyağı, yoğurt, ayran,kaymak, krema, vb.) (krem şantidahil) (katı veya toz halde kremahariç) Tehlikeli
10.52 Dondurma imalatı
10.52.01 Dondurma imalatı (sade,sebzeli, meyveli vb.) Az Tehlikeli
10.52.02 Şerbetli diğer yenilebilenbuzlu gıdaların imalatı Az Tehlikeli
10.6 Öğütülmüş tahıl ürünleri,nişasta ve nişastalı ürünlerinimalatı
10.61 Öğütülmüş hububat ve sebzeürünleri imalatı
10.61.01 Kahvaltılık tahıl ürünleri ilediğer taneli tahıl ürünlerininimalatı (buğday, yulaf, mısır,çavdar vb. ezmeleri ile mısırgevreği ve patlamış mısırdahil) Az Tehlikeli
10.61.02 Tahılların öğütülmesi ve unimalatı (mısır unu, kepek, razmoldahil, pirinç unu hariç) Tehlikeli
10.61.05 Pirinç, pirinç ezmesi ve pirinçunu imalatı (çeltik fabrikası veürünleri dahil) Tehlikeli
10.61.06 İrmik imalatı Tehlikeli
10.61.07 Ön pişirme yapılmış veya başkaşekilde hazırlanmış tane haldehububat imalatı (bulgur dahil,fakat mısır hariç) Tehlikeli
10.61.08 Sebzelerin ve baklagillerinöğütülmesi ve sebze unu ileezmelerinin imalatı (karışımlarıile hazır karıştırılmış sebzeunları dahil) (pişirilerekyapılanlar hariç) Tehlikeli
10.61.09 Fırıncılık ürünlerininimalatında kullanılan hamur ve unkarışımlarının imalatı (sebze unkarışımları hariç) Az Tehlikeli
10.61.10 Dövülmüş diğer tahılürünlerinin imalatı (keşkeklikbuğday vb. dahil) (bulgur ve irmikhariç) Az Tehlikeli
10.62 Nişasta ve nişastalı ürünlerinimalatı
10.62.01 Nişasta imalatı (buğday,pirinç, patates, mısır, manyok vb.ürünlerden) Tehlikeli
10.62.02 Glikoz, glikoz şurubu, fruktoz,maltoz, inulin, vb. imalatı (invertşeker dahil) Tehlikeli
10.62.04 Yaş mısırın öğütülmesi Tehlikeli
10.62.05 Glüten imalatı Tehlikeli
10.62.06 Mısır yağı imalatı Tehlikeli
10.7 Fırın ve unlu mamullerimalatı
10.71 Ekmek, taze pastane ürünleri vetaze kek imalatı
10.71.01 Taze pastane ürünleri imalatı(yaş pasta, kuru pasta, poğaça,kek, börek, pay, turta, wafflesvb.) Az Tehlikeli
10.71.02 Fırın ürünleri imalatı (ekmek,pide, simit, vb. dahil, tazepastane ürünlerinin imalatıhariç) Az Tehlikeli/td>
10.71.03 Hamur tatlıları imalatı(tatlandırılmış kadayıf, lokmatatlısı, baklava vb.) Az Tehlikeli
10.72 Peksimet ve bisküvi imalatı;dayanıklı pastane ürünleri vedayanıklı kek imalatı
10.72.01 Peksimet, bisküvi, gofret,dondurma külahı, kağıt helva vb.ürünlerin imalatı (çikolata kaplıolanlar dahil) Az Tehlikeli
10.72.02 Tatlı veya tuzlu hafifdayanıklı fırın ve pastaneürünlerinin imalatı (kurabiyeler,krakerler, galeta, gevrek halkalarvb.) Az Tehlikeli
10.72.03 Tatlandırılmamış dayanıklıhamur tatlıları imalatı (pişirilmişolsun olmasın tatlandırılmamışkadayıf, baklava vb.) (yufkaimalatı dahil) Az Tehlikeli
10.73 Makarna, şehriye, kuskus vebenzeri unlu mamullerinimalatı
10.73.03 Makarna, şehriye, kuskus vebenzeri mamullerin imalatı(doldurulmuş veya dondurulmuşolanlar dahil) Az Tehlikeli
10.8 Diğer gıda maddelerininimalatı
10.81 Şeker imalatı
10.81.01 Şeker kamışından, pancardan,palmiyeden, akça ağaçtan şeker(sakkaroz) ve şeker ürünleriimalatı veya bunların rafineedilmesi (sıvı şeker ve melasüretimi dahil) Tehlikeli
10.81.03 Akçaağaç şurubu imalatı Tehlikeli
10.82 Kakao, çikolata ve şekerlemeimalatı
10.82.01 Çikolata ve kakao içerenşekerlemelerin imalatı (beyazçikolata ve sürülerek yenilebilenkakaolu ürünler hariç) Az Tehlikeli
10.82.02 Şekerlemelerin ve şekerpastillerinin imalatı (bonbonşekeri vb.) (kakaolu şekerlemelerhariç) Az Tehlikeli
10.82.03 Sürülerek yenebilen kakaoluürünler imalatı Az Tehlikeli
10.82.04 Lokum, pişmaniye, helva,karamel, koz helva, fondan, beyazçikolata vb. imalatı (tahin helvasıdahil) Az Tehlikeli
10.82.05 Ciklet imalatı (sakız) Az Tehlikeli
10.82.06 Sert kabuklu meyve, meyvekabuğu ve diğer bitki parçalarındanşekerleme imalatı (meyan kökühülasaları dahil) Az Tehlikeli
10.82.07 Kakao tozu, kakao ezmesi/hamuruve kakao yağı imalatı Az Tehlikeli
10.83 Kahve ve çayın işlenmesi
10.83.01 Çay ürünleri imalatı (siyahçay, yeşil çay ve poşet çay ile çayekstreleri, esansları vekonsantreleri) Az Tehlikeli
10.83.02 Kahve ürünleri imalatı(çekilmiş kahve, eritilebilir kahveile kahve ekstre, esans vekonsantreleri) Az Tehlikeli
10.83.03 Bitkisel çayların imalatı(nane, yaban otu, papatya, ıhlamur,kuşburnu vb. çaylar). Az Tehlikeli
10.83.04 Kahve içeren ve kahve yerinegeçebilecek ürünlerin imalatı(şeker, süt vb. karıştırılmışürünler dahil) Az Tehlikeli
10.84 Baharat, sos, sirke ve diğerçeşni maddelerinin imalatı
10.84.01 Baharat imalatı (karabiber,kırmızı toz/pul biber, hardal unu,tarçın, yenibahar, damla sakızı,baharat karışımları vb.)(işlenmiş) Az Tehlikeli
10.84.02 Sirke ve sirke ikamelerininimalatı Tehlikeli
10.84.03 Sos ve çeşnilerin imalatı (soyasosu, ketçap, mayonez, hardal sosu,çemen, mango çeşnisi vb.) (baharat,sirke ve salça hariç) Tehlikeli
10.84.05 Gıda tuzu imalatı Az Tehlikeli
10.85 Hazır yemeklerin imalatı
10.85.01 Hazır yemek imalatı (vakumlapaketlenmiş veya korunmuş olanlar)(lokanta ve catering hizmetlerihariç) Az Tehlikeli
10.86 Homojenize gıda müstahzarlarıve diyetetik gıda imalatı
10.86.01 Bebek ve çocuklarınbeslenmesinde kullanılanmüstahzarların imalatı (bebekmamaları, pudingleri vb.) Az Tehlikeli
10.86.02 Hastalar için veya diyet amaçlıhazırlanan homojenize gıdamüstahzarlarının imalatı (glüteniçermeyen gıda maddeleri, sodyumiçermeyen tuzlar vb. gıdalar) Az Tehlikeli
10.86.03 Besin yönündenzenginleştirilmiş sporcuyiyeceklerinin imalatı Az Tehlikeli
10.89 Başka yerde sınıflandırılmamışdiğer gıda maddelerininimalatı
10.89.01 Hazır çorba ile hazır et suyu,balık suyu, tavuk suyu vekonsantrelerinin imalatı Az Tehlikeli
10.89.02 Maya ve kabartma tozu imalatı(bira mayası dahil) Tehlikeli
10.89.04 Suni bal, karamela, kabuksuzyumurta, yumurta albümini vb.imalatı Az Tehlikeli
10.89.05 Bitki özsu ve ekstreleri ilepeptik maddeler, müsilaj ve kıvamarttırıcı maddelerin imalatı (kolakonsantresi, malt özü, meyan balıdahil) Tehlikeli
10.89.06 Başka yerde sınıflandırılmamışçeşitli gıda ürünleri imalatı(çabuk bozulan hazır gıdalar,peynir fondüleri, şeker şuruplarıvb. dahil) Az Tehlikeli
10.9 Hazır hayvan yemleriimalatı
10.91 Çiftlik hayvanları için hazıryem imalatı
10.91.01 Çiftlik hayvanları için hazıryem imalatı Tehlikeli
10.92 Ev hayvanları için hazır gıdaimalatı
10.92.01 Ev hayvanları için hazır gıdaimalatı (kedi ve köpek mamaları,kuş ve balık yemleri vb.) Tehlikeli
11 İçeceklerin imalatı
11.0 İçeceklerin imalatı
11.01 Alkollü içeceklerindamıtılması, arıtılması veharmanlanması
11.01.01 Damıtılmış alkollü içeceklerinimalatı (viski, brendi, cin, likör,rakı, votka, kanyak vb.) Çok Tehlikeli
11.01.02 Damıtılmış alkollü içeceklerlekarıştırılmış içki imalatı Çok Tehlikeli
11.01.03 Etil alkol üretimi (doğalözellikleri değiştirilmemiş/tağyiredilmemiş, alkol derecesi <yüzde 80) Çok Tehlikeli
11.02 Üzümden şarap imalatı
11.02.01 Üzümden şarap, köpüklü şarap,şampanya vb. üretimi Tehlikeli
11.02.02 Üzüm şırası imalatı Tehlikeli
11.03 Elma şarabı ve diğer meyveşaraplarının imalatı
11.03.01 Elma şarabı ve diğer meyveşaraplarının imalatı Tehlikeli
11.04 Diğer damıtılmamış mayalıiçeceklerin imalatı
11.04.02 Diğer damıtılmamış mayalıiçeceklerin imalatı (vermut vebenzeri içkiler dahil) Tehlikeli
11.05 Bira imalatı
11.05.01 Bira imalatı Tehlikeli
11.06 Malt imalatı
11.06.01 Malt imalatı Tehlikeli
11.07 Alkolsüz içeceklerin imalatı;maden sularının ve diğer şişelenmişsuların üretimi
11.07.01 Doğal veya suni maden sularınınüretimi (tatlandırılmış vearomalandırılmış olanlardahil) Az Tehlikeli
11.07.02 Diğer alkolsüz içeceklerinüretimi (limonata, gazoz, kolalıiçecekler, meyveli içecekler,tonik, buzlu çay vb. içecekler)(içme suyu ve maden sularıhariç) Az Tehlikeli
11.07.03 İçme suyu üretimi (şişelenmiş,gazsız, tatlandırılmamış vearomalandırılmamış) Az Tehlikeli
11.07.04 Boza imalatı Tehlikeli
12 Tütün ürünleri imalatı
12.0 Tütün ürünleri imalatı
12.00 Tütün ürünleri imalatı
12.00.04 Tütün ürünleri imalatı Tehlikeli
13 Tekstil ürünlerininimalatı
13.1 Tekstil elyafının hazırlanmasıve bükülmesi
13.10 Tekstil elyafının hazırlanmasıve bükülmesi
13.10.03 Doğal pamuk elyafının imalatı(kardelenmesi, taraklanması,vb.) Tehlikeli
13.10.05 Doğal yün ve tiftik elyafınınimalatı (kardelenmesi,taraklanması, yün yağınıngiderilmesi, karbonize edilmesi veyapağının boyanması vb.) Tehlikeli
13.10.06 Doğal jüt, keten ve diğerbitkisel tekstil elyaflarınınimalatı (kardelenmesi, taraklanmasıvb.) (pamuk hariç) Tehlikeli
13.10.08 İpeğin kozadan ayrılması vesarılması Tehlikeli
13.10.09 Sentetik veya suni devamsızelyafın kardelenmesi vetaraklanması Tehlikeli
13.10.10 Doğal ipeğin bükülmesi ve iplikhaline getirilmesi Tehlikeli
13.10.12 Pamuk elyafının bükülmesi veiplik haline getirilmesi Tehlikeli
13.10.13 Yün ve tiftik elyafınınbükülmesi ve iplik halinegetirilmesi Tehlikeli
13.10.14 Jüt, keten ve diğer bitkiseltekstil elyaflarının bükülmesi veiplik haline getirilmesi (pamukhariç) Tehlikeli
13.10.15 Suni ve sentetik elyaflarınbükülmesi ve iplik halinegetirilmesi (filament ipliği vesuni ipek elyafı imalatıhariç) Tehlikeli
13.2 Dokuma
13.20 Dokuma
13.20.14 Kot kumaşı imalatı Tehlikeli
13.20.16 Pamuklu dokuma kumaş imalatı(havlu, peluş, vb. ilmeğikesilmemiş kumaşlar ile kot, kadifeve tafting kumaşlar hariç) Tehlikeli
13.20.17 Doğal kıl ve yünden dokumakumaş imalatı Tehlikeli
13.20.19 Doğal ipekten kumaşimalatı Tehlikeli
13.20.20 Keten, rami, kenevir, jütelyafları ile diğer bitkiseltekstil elyaflarından dokuma kumaşimalatı (pamuk hariç) Tehlikeli
13.20.21 Havlı, şönil, havlu, pelüş,tırtıl ve benzeri ilmeği kesilmemişdokuma kumaşlar ile tafting kumaşimalatı Tehlikeli
13.20.22 Suni ve sentetik filamentlerdenve devamsız elyaflardan dokumakumaş imalatı (havlu, peluş, vb.ilmeği kesilmemiş kumaşlar ilekadife ve tafting kumaşlarhariç) Tehlikeli
13.20.23 Dokuma yoluyla imitasyon(taklit) kürk kumaş imalatı Tehlikeli
13.20.24 Cam elyafından dokuma kumaşimalatı (cam elyafından darkumaşlar dahil) Tehlikeli
13.3 Tekstil ürünlerininbitirilmesi
13.30 Tekstil ürünlerininbitirilmesi
13.30.01 Kumaş ve tekstil ürünleriniağartma ve boyama hizmetleri (giyimeşyası dahil) Tehlikeli
13.30.02 Tekstil elyaf ve iplikleriniağartma ve boyama hizmetleri(kasarlama dahil) Tehlikeli
13.30.03 Kumaş ve tekstil ürünlerinebaskı yapılması hizmetleri (giyimeşyası dahil) Tehlikeli
13.30.04 Kumaş ve tekstil ürünlerineilişkin diğer bitirme hizmetleri(apreleme, pliseleme, sanforlama,vb. dahil) Tehlikeli
13.9 Diğer tekstil ürünlerininimalatı
13.91 Örgü (triko) veya tığ işi(kroşe) kumaşların imalatı
13.91.01 Örgü ve tığ işi kumaşlarınimalatı (penye ve havlı kumaşlarile raschel veya benzeri makinelerile örülen tül, perde, vb. örgüveya tığ ile örülmüş ürünlerdahil) Tehlikeli
13.91.02 Örme yoluyla imitasyon (taklit)kürk kumaşı imalatı Tehlikeli
13.92 Giyim eşyası dışındakitamamlanmış tekstil ürünlerininimalatı
13.92.01 Yatak örtü takımları, yatakçarşafları, yastık kılıfları, masaörtüsü ile tuvalet ve mutfaktakullanılan örtülerin imalatı (el veyüz havluları dahil) Tehlikeli
13.92.02 Yorgan, kuştüyü yorgan, minder,puf, yastık, halı yastık, uykutulumu ve benzerlerininimalatı Tehlikeli
13.92.03 Perdelerin ve iç storların,perde veya yatak saçaklarının,farbelalarının ve malzemelerininimalatı (gipür, tül perde ve kalınperdeler dahil) Tehlikeli
13.92.04 Tekstilden yer bezi, bulaşıkbezi, toz bezi vb. temizlik bezleriimalatı Tehlikeli
13.92.05 Battaniye imalatı Tehlikeli
13.92.06 Tekstilden çuval, torba, çantave benzerlerinin imalatı (eşyapaketleme amacıylakullanılanlar) Tehlikeli
13.92.07 Can yeleği ve can kurtaransimidi imalatı Tehlikeli
13.92.08 Paraşüt (yönlendirilebilenparaşütler dahil) ve rotoşüt ilebunların parçalarının imalatı Tehlikeli
13.92.09 Bayrak, sancak ve flamaimalatı Tehlikeli
13.92.10 Tekstilden örtü ve kılıfimalatı (araba, makine, mobilya vb.için) Tehlikeli
13.92.11 Branda, tente, stor (güneşlik),yelken, çadır ve kamp malzemeleriimalatı (şişme yataklar dahil) Tehlikeli
13.93 Halı ve kilim imalatı
13.93.01 Halı (duvar halısı dahil) vekilim imalatı (paspas, yolluk vebenzeri tekstil yer kaplamalarıdahil) Tehlikeli
13.93.02 Halı, kilim vb. içinçözgücülük, halı oymacılığı vb.faaliyetler Az Tehlikeli
13.94 Halat, urgan, kınnap ve ağimalatı
13.94.02 Ağ ve ağ ürünleri imalatı,sicim, kınnap, halat veya urgandan(balık ağı, yük boşaltma ağları,vb.) Az Tehlikeli
13.94.03 Sicim, urgan, halat, kordon vebenzerleri imalatı (kauçuk veyaplastik emdirilmiş, kaplanmışolanlar dahil) Tehlikeli
13.95 Dokusuz kumaşların ve dokusuzkumaştan yapılan ürünlerin imalatı,giyim eşyası hariç
13.95.01 Dokusuz kumaşlar ile bunlardanyapılan ürünlerin imalatı (giyimeşyası hariç) Tehlikeli
13.96 Diğer teknik ve endüstriyeltekstillerin imalatı
13.96.01 Dokunabilir ipliklerdenmetalize iplik ve metalize gipeiplik ile bunlardan dokuma kumaşimalatı (giyim ve döşemeciliktekullanılan) Tehlikeli
13.96.02 Tekstil malzemelerinden parçahalinde kordonlar; işlemeyapılmamış şeritçi eşyası vebenzeri süs eşyalarınınimalatı Az Tehlikeli
13.96.03 Dar dokuma kumaşların imalatı(etiket, arma ve diğer benzerieşyalar hariç) Tehlikeli
13.96.04td> Tekstil malzemelerinden dokumaetiket, rozet, arma ve diğerbenzeri eşyaların imalatı Az Tehlikeli
13.96.05 Teknik kullanım amaçlı tekstilürünleri ve eşyaları imalatı(fitil, lüks lambası gömleği,tekstil malzemesinden hortumlar,taşıma veya konveyör bantları, elekbezi ve süzgeç bezi dahil) Tehlikeli
13.96.06 Kord bezi imalatı Tehlikeli
13.96.07 Tekstille kaplanmış kauçukiplik veya kordon ile kauçuk veyaplastikle kaplanmış veya emdirilmiştekstilden iplik veya şeritler vebunlardan yapılmış mensucatimalatı Tehlikeli
13.96.08 Kaplanmış veya emdirilmiştekstil kumaşlarının imalatı (ciltkapağı için mensucat, mühendismuşambası, tiyatro dekorları, tuvalvb. dahil) Tehlikeli
13.99 Başka yerde sınıflandırılmamışdiğer tekstillerin imalatı
13.99.02 Tül ve diğer ağ kumaşların(dokuma, örgü (triko) veya tığ işi(kroşe) olanlar hariç) imalatı ileoya, dantel ve nakış imalatı (yaka,fisto yaka, lez, aplik, motif,kapitone ürünleri vb. dahil) Tehlikeli
13.99.03 Keçe, basınçlı hassas giysidokumaları, tekstilden ayakkabıbağı, pudra ponponu vb.imalatı Tehlikeli
13.99.04 Tekstil kırpıntısı imalatı(yatak, yorgan, yastık, şilte vebenzeri doldurmak için) Tehlikeli
13.99.06 Gipe iplik ve şeritlerin, şönilipliklerin, şenet ipliklerinimalatı (metalize olanlar ile gipelastikler hariç) Tehlikeli
14 Giyim eşyalarının imalatı
14.1 Kürk hariç, giyim eşyasıimalatı
14.11 Deri giyim eşyası imalatı
14.11.05 Deri giyim eşyası imalatı (derikarışımlı olanlar dahil, ayakkabıhariç) Tehlikeli
14.12 İş giysisi imalatı
14.12.07 Endüstriyel iş giysisi (işönlükleri, iş elbiseleri, iştulumları, vb.) imalatı (dikişsizplastik olanlar ile ateşe dayanıklıve koruyucu güvenlik kıyafetlerihariç) Az Tehlikeli
14.12.08 Mesleki kıyafet imalatı (resmive özel üniforma vb. ile okulönlükleri dahil, endüstriyel işgiysileri hariç) Az Tehlikeli
14.13 Diğer dış giyim eşyalarıimalatı
14.13.04 Dış giyim eşyası imalatı,dokuma, örme (trikotaj) ve tığ işi(kroşe), vb. kumaştan olanlar(kaban, palto, ceket, pantolon,takım elbise, döpiyes, anorak,yağmurluk, gece kıyafetleri vb.)(iş giysileri ve terzilerinfaaliyetleri hariç) Az Tehlikeli
14.13.05 Siparişe göre ölçü alınarak dışgiyim eşyası imalatı, dokuma, örgü(triko) ve tığ işi (kroşe), vb.kumaştan olanlar (terzilerinfaaliyetleri) (giyim eşyası tamiriile gömlek imalatı hariç) Az Tehlikeli
14.13.06 Sahne ve gösteri elbiseleriimalatı, dokuma, örgü (triko) vetığ işi (kroşe), vb. kumaştanolanlar Az Tehlikeli
14.13.07 Gelinlik imalatı Az Tehlikeli
14.14 İç giyim eşyası imalatı
14.14.01 Gömlek, tişört, bluz, vb. ceketaltına giyilebilen giyim eşyasıimalatı (dokuma, örgü veya tığ işikumaştan) Az Tehlikeli
14.14.02 Gecelik, sabahlık, pijama,bornoz ve ropdöşambır imalatı(dokuma, örgü veya tığ işikumaştan) Az Tehlikeli
14.14.03 Atlet, fanila, külot, slip, içetek, kombinezon, jüp, jüpon,sütyen, korse vb. iç çamaşırıimalatı (dokuma, örgü veya tığ işikumaştan) Az Tehlikeli
14.14.04 Çorap bağları, jartiyer,pantolon askıları ve benzeri içgiyim aksesuarları imalatı (dokuma,örgü veya tığ işi kumaştan) Az Tehlikeli
14.19 Diğer giyim eşyalarının vegiysi aksesuarlarının imalatı
14.19.01 Spor ve antrenman giysileri,kayak kıyafetleri, yüzmekıyafetleri vb. imalatı (mayo,bikini dahil) (dokuma, örgü veyatığ işi kumaştan) Az Tehlikeli
14.19.02 Yazma, tülbent, eşarp, vb.imalatı (dokuma, örgü veya tığ işikumaştan) Tehlikeli
14.19.04 Eldiven, kemer, şal, papyon,kravat, saç fileleri, kumaş mendil,atkı, fular, duvak vb. giysiaksesuarları imalatı (deriden,dokusuz kumaştan veya dokuma, örgüveya tığ işi kumaştan) (bebekleriçin olanlar hariç) Az Tehlikeli
14.19.05 Bebek giyim eşyası veaksesuarları imalatı (dokuma, örgüveya tığ işi kumaştan) (tabansızpanduf dahil) Az Tehlikeli
14.19.07 Şapka, kep, başlık, kasket,tabla ve el manşonları ile bunlarınparçalarının imalatı (kürkten şapkave başlıklar dahil, bebekler içinolanlar hariç) Az Tehlikeli
14.19.08 Giyim eşyası imalatı (keçedenveya diğer dokusuz kumaştan ya daemdirilmiş veya kaplanmış tekstilkumaşından olanlar) Az Tehlikeli
14.2 Kürkten eşya imalatı
14.20 Kürkten eşya imalatı
14.20.04 Post, kürk veya kürklü deridenyapılmış eşya ve parçaların imalatı(giyim eşyası ve giysi aksesuarlarıhariç) Tehlikeli
14.20.05 Post, kürk veya kürklü deridenyapılmış giyim eşyası ve giysiaksesuarları imalatı (kürktenşapka, başlık ve eldivenhariç) Tehlikeli
14.3 Örme (trikotaj) ve tığ işi(kroşe) ürünlerin imalatı
14.31 Örme (trikotaj) ve tığ işi(kroşe) çorap imalatı
14.31.01 Çorap imalatı (örme ve tığ işiolan külotlu çorap, tayt çorap,kısa kadın çorabı, erkek çorabı,patik ve diğer çoraplar) Az Tehlikeli
14.39 Örme (trikotaj) ve tığ işi(kroşe) diğer giyim eşyasıimalatı
14.39.01 Örgü (triko) ve tığ işi (kroşe)diğer giyim eşyası imalatı(doğrudan süveter, kazak, hırka,yelek, vb. şekillerdeüretilenler) Az Tehlikeli
15 Deri ve ilgili ürünlerinimalatı
15.1 Derinin tabaklanması veişlenmesi; bavul, el çantası,saraçlık ve koşum takımı imalatı;kürkün işlenmesi ve boyanması
15.11 Derinin tabaklanması veişlenmesi; kürkün işlenmesi veboyanması
15.11.10 Deri ve kürklü deri imalatı(kürkün ve derinin tabaklanması,sepilenmesi, boyanması, cilalanmasıve işlenmesi) Çok Tehlikeli
15.11.11 Kürklü derinin ve postlarınkazınarak temizlenmesi, kırkılması,tüylerinin yolunması ve ağartılması(postlu derilerin terbiyesidahil) Çok Tehlikeli
15.11.13 Deri ve kösele esaslı terkipile elde edilen levha, yaprak,şerit deri ve kösele imalatı Çok Tehlikeli
15.12 Bavul, el çantası ve benzerleriile saraçlık ve koşum takımıimalatı (deri giyim eşyasıhariç)
15.12.07 Deri, kösele, karma deri vediğer malzemelerden bavul, elçantası, cüzdan, okul çantası,evrak çantası, deriden sigaralık,deri ayakkabı bağı, kişisel bakım,dikiş, vb. amaçlı seyahat seti, vb.ürünlerin imalatı Tehlikeli
15.12.08 Deriden veya diğermalzemelerden saraçlık ve koşumtakımı imalatı (kamçı, semer, eyer,tasma kayışı, heybe, vb.) Tehlikeli
15.12.09 Deri saat kayışı imalatı Tehlikeli
15.12.10 Plastik veya kauçuk saat kayışıimalatı Tehlikeli
15.12.11 Kumaş ve diğer malzemelerdensaat kayışı imalatı (metal olanlarhariç) Az Tehlikeli
15.12.12 Tabii/terkip yoluyla eldeedilen deri ve köseleden taşıma vekonveyör bantları imalatı Tehlikeli
15.2 Ayakkabı, bot, terlik vb.imalatı
15.20 Ayakkabı, bot, terlik vb.imalatı
15.20.15 Deriden ayakkabı, mes, bot,çizme, postal, terlik, vb. imalatı(tamamıyla tekstilden olanlar ileortopedik ayakkabı ve kayakayakkabısı hariç) Tehlikeli
15.20.17 Plastik veya kauçuktanayakkabı, bot, çizme, postal,terlik, vb. imalatı (tamamıylatekstilden olanlar ile ortopedikayakkabı ve kayak ayakkabısıhariç) Tehlikeli
15.20.18 Tekstilden ve diğermalzemelerden ayakkabı, mes, bot,çizme, postal, terlik, vb. imalatı(deri ve plastik olanlar iletamamıyla tekstilden olanlar,ortopedik ayakkabı ve kayakayakkabısı hariç) Tehlikeli
15.20.19 Ayakkabıların deri kısımlarınınve ayakkabı parçalarının (kauçuk,plastik ve ahşap parçalar hariç)imalatı (üst ve alt parçaları,topuklar, vb. imalatı ile sayacılıkfaaliyetleri dahil) Tehlikeli
16 Ağaç, ağaç ürünleri ve mantarürünleri imalatı (mobilya hariç);saz, saman ve benzeri malzemelerdenörülerek yapılan eşyalarınimalatı
16.1 Ağaçların biçilmesi veplanyalanması
16.10 Ağaçların biçilmesi veplanyalanması
16.10.01 Kereste imalatı (ağaçlarınbiçilmesi, planyalanması,rendelenmesi ve şekillendirilmesifaaliyetleri) Tehlikeli
16.10.02 Ahşap demir yolu veya tramvaytraversi imalatı Tehlikeli
16.10.03 Ağaç yünü, ağaç unu, ağaçtalaşı, ağaç yonga imalatı Çok Tehlikeli
16.10.05 Ahşap döşemelerin ve yerdöşemelerinin imalatı(birleştirilebilir parkelerhariç) Tehlikeli
16.10.06 Tomruk ve kerestelerinkurutulması, emprenye edilmesi veyakimyasal işlemden geçirilmesihizmetleri (başkalarınınadına) Çok Tehlikeli
16.2 Ağaç, mantar, kamış ve örgümalzeme ürünü imalatı
16.21 Ahşap kaplama paneli ve ağaçesaslı panel imalatı
16.21.01 Ahşap, bambu ve diğer odunsumalzemelerden kaplamalık plaka,levha, vb. imalatı (yaprak halde)(preslenmemiş) Tehlikeli
16.21.02 Sıkıştırılmış lif, tahta vetabakalardan kontrplak, mdf, sunta,vb. levha imalatı Çok Tehlikeli
16.22 Birleştirilmiş parke yerdöşemelerinin imalatı
16.22.01 Birleştirilebilir ahşap parkeyer döşemelerinin imalatı (lamineve laminat parkeler hariç) Tehlikeli
16.23 Diğer bina doğramacılığı vemarangozluk ürünlerininimalatı
16.23.01 Ahşap pencere, kapı ve bunlarınkasaları ve eşikleri ile ahşapmerdiven, tırabzan, veranda,parmaklık vb. imalatı Tehlikeli
16.23.02 Ahşap prefabrik yapılar veahşap taşınabilir evlerinimalatı Tehlikeli
16.23.90 Başka yerde sınıflandırılmamışinşaat doğrama ve marangozlukürünleri (ahşaptan kiriş, kalas,payanda, beton kalıbı, çatıpadavrası, vb.) imalatı Tehlikeli
16.24 Ahşap konteyner imalatı
16.24.01 Kutu, sandık, fıçı ve benzeriahşap ambalaj malzeme imalatı Tehlikeli
16.24.02 Palet, kutu palet ve diğerahşap yükleme tablalarıimalatı Tehlikeli
16.24.03 Ahşap kablo makarası, bobin,takoz, vb. imalatı Tehlikeli
16.29 Diğer ağaç ürünleri imalatı;mantardan, saz, saman ve benzeriörme malzemelerinden yapılmışürünlerin imalatı
16.29.01 Ahşap mutfak ve sofra eşyasıimalatı (kaşık, kepçe, spatula,bardak, havan, havan eli, tepsivb.) Az Tehlikeli
16.29.02 Doğal mantar (kabacaköşelendirilmiş veya blok, levhavb. halde), ezilmiş veya granülhaline getirilmiş mantar ile doğalmantar veya aglomera mantarürünlerinin imalatı (mantardan yerdöşemeleri, makara, tıpa ve tıkaçdahil) Az Tehlikeli
16.29.03 Sedef kakma ahşap işleri, kakmaile süslü ahşap eşyalar, mücevheriçin veya çatal-kaşık takımı vebenzeri eşyalar için ahşap kutular,ahşap biblo, heykel ve diğersüslerin imalatı Az Tehlikeli
16.29.04 Ahşaptan iş aletleri, aletgövdeleri, alet sapları, süpürgeveya fırça gövdeleri ile sapları,ayakkabı kalıpları, ahşap mandal,elbise ve şapka askılarıimalatı Tehlikeli
16.29.05 Ahşap çerçeve (tablo, fotoğraf,ayna ve benzeri nesneler için) veahşaptan diğer eşyaların imalatı(panolar, tuval için çerçeveler, ipvb. için makaralar, ayakkabınınahşap topuk ve tabanları, arıkovanları, köpek kulübeleridahil) Tehlikeli
16.29.07 Hasır veya diğer örmemalzemesinden (kamış, saz, samanvb.) eşyaların imalatı ile sepettürü ve hasır işi eşyalarınimalatı Az Tehlikeli
16.29.90 Başka yerde sınıflandırılmamışdiğer ağaç ürünleri ile enerji içinyakıt kütükleri ve peletlerininimalatı (karbonlaştırılmamışolanlar) Tehlikeli
17 Kağıt ve kağıt ürünlerininimalatı
17.1 Kağıt hamuru, kağıt ve mukavvaimalatı
17.11 Kağıt hamuru imalatı
17.11.08 Kağıt hamuru imalatı Tehlikeli
17.12 Kağıt ve mukavva imalatı
17.12.07 Kağıt ve mukavva imalatı (dahaileri sanayi işlemleri için ruloveya tabaka halinde) (ziftli,lamine, kaplanmış ve emprenyeedilmiş olanlar ile krepon vekırışık kağıtlar dahil) Tehlikeli
17.2 Kağıt ve mukavva ürünleriimalatı
17.21 Oluklu kağıt ve mukavva imalatıile kağıt ve mukavvadan yapılanmuhafazaların imalatı
17.21.10 Bürolarda, dükkanlarda vebenzeri yerlerde kullanılan kağıtevrak tasnif kutuları, mektupkutuları ve benzeri eşyalarınimalatı Tehlikeli
17.21.11 Kağıt ve kartondan torba veçanta imalatı (kese kağıdıdahil) Tehlikeli
17.21.12 Kağıt veya mukavvadan koli,kutu ve benzeri muhafazalarınimalatı Tehlikeli
17.21.13 Oluklu kağıt ve oluklu mukavvaimalatı (rulo veya tabakahalinde) Tehlikeli
17.22 Kağıttan yapılan ev eşyası,sıhhi malzemeler ve tuvaletmalzemeleri imalatı
17.22.02 Kullanıma hazır tuvalet kağıdı,kağıt mendil, temizlik veya yüztemizleme için kağıt mendil vehavlular ile masa örtüsü vepeçetelerin imalatı (kağıthamurundan, kağıttan, selülozvatkadan veya selüloz lifliağlardan yapılmış) Tehlikeli
17.22.03 Kağıt veya mukavvadan yapılmıştepsi, tabak, kase, bardak vebenzerlerinin imalatı Tehlikeli
17.22.04 Hijyenik havlu ve tamponlar,kadın bağı, pedler, bebek bezlerivb. hijyenik ürünler ile giyimeşyası ve giysi aksesuarlarınınimalatı (kağıt hamurundan,kağıttan, selüloz vatkadan veyaselüloz lifli ağlardanyapılmış) Tehlikeli
17.23 Kağıt kırtasiye ürünleriimalatı
17.23.04 Kullanıma hazır karbon kağıdı,kendinden kopyalı kağıt ve diğerkopyalama veya transfer kağıtları,mumlu teksir kağıdı, kağıttan ofsettabakalar ile tutkallı veyayapışkanlı kağıtların imalatı Tehlikeli
17.23.06 Kağıt veya mukavvadan ananiteliği bilgi içermeyen eğitim veticari kırtasiye malzemeleriimalatı (ajandalar, defterler,sicil defterleri, muhasebedefterleri, ciltler, kayıt formlarıve diğer benzeri kırtasiyeürünleri) Tehlikeli
17.23.07 Kağıt veya mukavvadan dosya,portföy dosya, klasör vebenzerlerinin imalatı Tehlikeli
17.23.08 Kullanıma hazır basım ve yazımkağıdı ile diğer kağıt vemukavvaların imalatı (basılıolanlar hariç) Tehlikeli
17.23.09 Baskısız zarf, mektup kartı,yazışma kartı ve benzerlerininimalatı Tehlikeli
17.24 Duvar kağıdı imalatı
17.24.02 Duvar kağıdı ve benzeri duvarkaplamalarının imalatı (tekstilduvar kaplamaları hariç) Tehlikeli
17.24.03 Tekstil duvar kaplamalarınınimalatı Tehlikeli
17.29 Kağıt ve mukavvadan diğerürünlerin imalatı
17.29.01 Kağıt veya mukavvadanetiketlerin imalatı Tehlikeli
17.29.02 Filtre kağıdı, kartonları vemukavvaları, kağıt hamurundanfiltre edici blok ve levhalar ilekalıplanmış ya da sıkıştırılmışeşyaların imalatı (kağıt veyakarton esaslı contalar verondelalar dahil) Tehlikeli
17.29.03 Sigara kağıdı, kağıt vemukavvadan bobin, makara, masura,yumurta viyolü ve benzeri kağıt,mukavva veya kağıt hamurundandestekler ile kağıttan hediyelik vesüs eşyaları imalatı Tehlikeli
17.29.04 Jakar makinelerinde kullanmakiçin kağıt ve mukavvadan kartlarile kaydedici cihazlara mahsusdiyagram kağıtları imalatı (bobin,tabaka/disk halinde) Tehlikeli
18 Kayıtlı medyanın basılması veçoğaltılması
18.1 Basım ve basım ile ilgilihizmet faaliyetleri
18.11 Gazetelerin basımı
18.11.01 Gazetelerin, dergilerin vesüreli yayınların basım hizmetleri(haftada dört veya daha fazlayayınlananlar) Tehlikeli
18.12 Diğer matbaacılık
18.12.01 Çıkartma, takvim, ticarikatalog, tanıtım broşürü, poster,satış bülteni, kartpostal, davetiyeve tebrik kartları, yıllık, rehber,resim, çizim ve boyama kitapları,çizgi roman vb. basımhizmetleri Tehlikeli
18.12.02 Gazetelerin, dergilerin vesüreli yayınların basım hizmetleri(haftada dört kereden daha azyayınlananlar) Tehlikeli
18.12.03 Ansiklopedi, sözlük, kitap,kitapçık, müzik eserleri ve müzikel yazmaları, atlas, harita vb.basım hizmetleri Tehlikeli
18.12.04 Röprodüksiyon basımı (bir sanateserinin aslını bozmadanbasılması) Tehlikeli
18.12.05 Serigrafi faaliyetleri Tehlikeli
18.12.06 Posta pulu, damga pulu, matbubelgeler, tapu senetleri, akıllıkart, çek defterleri, kağıt para vediğer değerli kağıtların vebenzerlerinin basım hizmetleri Tehlikeli
18.12.07 Plastik, cam, metal, ağaç veseramik üstüne baskıhizmetleri Tehlikeli
18.13 Basım ve yayım öncesihizmetler
18.13.01/td> Basımda kullanmak üzere baskıklişeleri ya da silindirleri ilediğer basım unsurlarının üretilmesi(klişecilik vb.) ile mizanpaj,dizgi, tabaka yapım hizmetleri,gravür baskı için silindirlerinkazınması veya asitle aşındırılmasıvb. hizmetler Çok Tehlikeli
18.13.02 Basım öncesi bilgisayardestekli hizmetler (bilgisayardestekli sayfa tasarımı ile saydam,asetat, reprografik sunum araçlarıve diğer sayısal sunum ortamları,taslaklar, planlar vb. baskıürünlerinin tasarlanması) (masaüstü yayımcılık dahil) Az Tehlikeli
18.14 Ciltçilik ve ilgilihizmetler
18.14.01 Ciltçilik ve ilgilihizmetler/mücellitlik (katlama,birleştirme, dikme, yapıştırma,kesme, kapak takma gibi işlemlerile damgalama, Braille alfabesikopyalama vb. hizmetler) Tehlikeli
18.2 Kayıtlı medyanınçoğaltılması
18.20 Kayıtlı medyanınçoğaltılması
18.20.02 Ses ve görüntü kayıtlarınınçoğaltılması hizmetleri (CD’lerin,DVD’lerin, kasetlerin vebenzerlerinin asıl (master)kopyalarından çoğaltılması) Az Tehlikeli
18.20.03 Yazılımların çoğaltılmasıhizmetleri (CD, kaset vb.ortamlardaki bilgisayaryazılımlarının ve verilerin asıl(master) kopyalarındançoğaltılması) Az Tehlikeli
19 Kok kömürü ve rafine edilmişpetrol ürünleri imalatı
19.1 Kok fırını ürünlerininimalatı
19.10 Kok fırını ürünlerininimalatı
19.10.10 Linyit ve turbadan kok fırınıürünlerinin imalatı (kok ve yarıkok kömürü, karni kömürü, katran,zift ve zift koku vb. ürünlerinimalatı ile kok kömürünün topakhaline getirilmesi dahil) Çok Tehlikeli
19.10.11 Taşkömüründen kok fırınıürünlerinin imalatı (kok ve yarıkok kömürü, karni kömürü, katran,zift ve zift koku vb. ürünlerinimalatı ile kok kömürünün topakhaline getirilmesi dahil) Çok Tehlikeli
19.2 Rafine edilmiş petrol ürünleriimalatı
19.20 Rafine edilmiş petrol ürünleriimalatı
19.20.12 Turba, linyit ve taş kömürübriketleri imalatı (kömür tozundanbasınçla elde edilen yakıt) Çok Tehlikeli
19.20.15 Petrol türevi yakıtların,petrol gazları ve diğerhidrokarbonların imalatı Çok Tehlikeli
19.20.16 Petrolden madeni yağların(yağlama ve makine yağları) imalatı(gres yağı dahil) Çok Tehlikeli
19.20.17 Vazelin, parafin mumu, petrolmumu, petrol koku, petrol bitümenive diğer petrol ürünlerininimalatı Çok Tehlikeli
19.20.19 Ağırlık itibariyle %70 veyadaha fazla oranda petrol yağlarıveya bitümenli yağlardan eldeedilen diğer karışımların üretimi(%70 petrol yağı ile karıştırılmışbiyodizelden ürünler dahil, madeniyağlar hariç) Çok Tehlikeli
20 Kimyasalların ve kimyasalürünlerin imalatı
20.1 Temel kimyasal maddelerin,kimyasal gübre ve azot bileşikleri,birincil formda plastik ve sentetikkauçuk imalatı
20.11 Sanayi gazları imalatı
20.11.01 Sanayi gazları imalatı(hidrojen, asal gazlar, azot,oksijen, karbondioksit veametallerin diğer inorganik oksijenbileşikleri, soğutucu-dondurucugazlar ile hava gibi sıvı veyasıkıştırılmış inorganik sanayigazları ve tıbbi gazlar) Çok Tehlikeli
20.12 Boya maddeleri ve pigmentimalatı
20.12.01 Boya maddeleri ve pigmentimalatı (birincil formda veyakonsantre olarak herhangi birkaynaktan) (hazır boyalarhariç) Çok Tehlikeli
20.13 Diğer inorganik temel kimyasalmaddelerin imalatı
20.13.02 Metalik halojenler,hipokloritler, kloratlar veperkloratların imalatı (çamaşırsuyu dahil) Çok Tehlikeli
20.13.03 Sülfidler (sülfürler),sülfatlar, fosfinatlar,fosfonatlar, fosfatlar venitratların imalatı (şapdahil) Çok Tehlikeli
20.13.04 Karbonatların imalatı (sodyum,kalsiyum ve diğerleri) (çamaşırsodası dahil) Çok Tehlikeli
20.13.06 Uranyum, plütonyum ve toryumcevherlerinin zenginleştirilmesi(nükleer reaktörler için yakıtkartuşları dahil) Çok Tehlikeli
20.13.07 Diğer metal tuzları ve temelinorganik kimyasalların imalatı(izotoplar ve bunların bileşikleri,oksometalik/peroksometalikasitlerin tuzları, siyanürler,boratlar, hidrojen peroksit,kükürt, kavrulmuş demir piritler,piezo-elektrik kuvarsı vb.) Çok Tehlikeli
20.13.90 Başka yerde sınıflandırılmamışkimyasal elementler, inorganikasitler ve bileşiklerin imalatı(klor, iyot, flor, bor, silisyum,fosfor, arsenik gibi metaloidler,skandium, cıva, oksitler,hidroksitler, hidrojen klorürvb.) Çok Tehlikeli
20.14 Diğer organik temelkimyasalların imalatı
20.14.01 Temel organik kimyasallarınimalatı (hidrokarbonlar, alkoller,asitler, aldehitler, ketonlar,sentetik gliserin, azot fonksiyonlubileşikler vb.) (etil alkol, sitrikasit dahil) Çok Tehlikeli
20.14.04 Odunun ve kömür katranınındamıtılması (odun kreozotu, odunnaftası, bitkisel zift, benzol,toluol, fenol, naftalin vb.) Çok Tehlikeli
20.14.05 Çam terebentin esansı ve zamkimalatı Tehlikeli
20.15 Kimyasal gübre ve azotbileşiklerinin imalatı
20.15.01 Fosfatlı veya potasyumlugübreler, iki (azot ve fosfor veyafosfor ve potasyum) veya üç besinmaddesi (azot, fosfor ve potasyum)içeren gübreler, sodyum nitrat ilediğer kimyasal ve mineralgübrelerin imalatı Çok Tehlikeli
20.15.02 Bileşik azotlu ürünlerinimalatı (nitrik asit, sülfonitrikasit, saf amonyak, amonyum klorür(nişadır), amonyum karbonat,nitritler, potasyum nitratlar vb.)(gübreler hariç) Çok Tehlikeli
20.16 Birincil formda plastikhammaddelerin imalatı
20.16.01 Birincil formda poliamitler,üre reçineleri, melamin reçineleri,vb. plastik hammaddelerinimalatı Çok Tehlikeli
20.16.02 Birincil formda alkid reçine,polyester reçine, epoksi reçine,poliasetal, polikarbonat ile diğerpolieter ve polyester imalatı Çok Tehlikeli
20.16.03 Birincil formda polimerlerinimalatı (etilen, propilen, stiren,vinil klorür, vinil asetat, vinilesterleri, akrilik vb. polimerleriile sertleştirilmiş proteinler,doğal kauçuğun kimyasal türevleridahil) Çok Tehlikeli
20.16.04 Birincil formda silikon vepolimer esaslı iyon değiştiricileriimalatı Çok Tehlikeli
20.16.05 Birincil formda diğer aminoreçineler, fenolik reçineler,poliüretanlar, politerpenler,polisülfürler, selüloz ve kimyasaltürevleri ile diğer petrolreçineleri imalatı Çok Tehlikeli
20.17 Birincil formda sentetik kauçukimalatı
20.17.01 Birincil formda sentetik kauçukimalatı Çok Tehlikeli
20.2 Haşere ilaçları ve diğerzirai-kimyasal ürünlerinimalatı
20.20 Haşere ilaçları ve diğerzirai-kimyasal ürünlerinimalatı
20.20.11 Böcek ilacı, kemirgen ilacı,küf ve mantar ilacı, yabancı otlamücadele ilacı imalatı Çok Tehlikeli
20.20.12 Dezenfektan imalatı (tarımsalve diğer kullanımlar için)(hijyenik maddeler, bakteriostatlarve sterilize ediciler dahil) Çok Tehlikeli
20.20.13 Çimlenmeyi önleyici ve bitkigelişimini düzenleyici ürünimalatı Çok Tehlikeli
20.20.14 Diğer zirai kimyasal ürünlerinimalatı (gübre ve azotlu bileşikimalatı hariç) Çok Tehlikeli
20.3 Boya, vernik ve benzerikaplayıcı maddeler ile matbaamürekkebi ve macun imalatı
20.30 Boya, vernik ve benzerikaplayıcı maddeler ile matbaamürekkebi ve macun imalatı
20.30.11 Polyester, akrilik ve vinilpolimer esaslı boya ve vernikimalatı Çok Tehlikeli
20.30.12 Macun imalatı (dolgu, cam,sıvama için olanlar ile üstübeç,vb. dahil) Çok Tehlikeli
20.30.13 Diğer boya, vernik ve ilgiliürünlerin imalatı (resim vetabelacı boyaları, matbaamürekkepleri, hazır boyapigmentleri, matlaştırıcılar,renklendiriciler, astarlar, camfirit, camlaştırılabilir emay vesırlar, solvent, inceltici(tiner)) Çok Tehlikeli
20.4 Sabun ve deterjan, temizlik veparlatıcı maddeleri; parfüm;kozmetik ve tuvalet malzemeleriimalatı
20.41 Sabun ve deterjan ile temizlikve parlatıcı maddeler imalatı
20.41.01 Kapalı alanlar için kokulumüstahzarlar ve koku gidericilerile suni mumların imalatı (kişiselkullanım için olanlar hariç) Tehlikeli
20.41.03 Ham gliserin (gliserol)imalatı Tehlikeli
20.41.04 Sabun, yıkama ve temizlememüstahzarları (deterjanlar) ilesabun olarak kullanılanmüstahzarlar imalatı (kişisel bakımiçin olanlar ile ovalama toz vekremleri hariç) Tehlikeli
20.41.06 Cila, krem ve ovalama krem vetozlarının imalatı (ayakkabı,mobilya, yer döşemesi, kaporta,cam, metal vb. için) Tehlikeli
20.42 Parfümlerin, kozmetiklerin vekişisel bakım ürünlerininimalatı
20.42.01 Ağız veya diş bakım ürünleriimalatı (diş macunu, vb. ile takmadişleri ağızda sabit tutmayayarayan macun ve tozlar ile diştemizleme iplikleri dahil) Tehlikeli
20.42.02 Kolonya imalatı Tehlikeli
20.42.03 Parfüm ve koku verici diğersıvı ürün, manikür/pedikürmüstahzarı, güneş koruyucu ürünler,dudak ve göz makyajı ürünü, banyotuzu, kozmetik veya kişisel bakımamaçlı pudra, sabun ve organikyüzey aktif müstahzarı, deodorant,vb. imalatı (kolonya hariç) Tehlikeli
20.42.04 Şampuan, saç kremi, saç spreyi,jöle, saç düzleştirme ve permaürünleri, saç losyonları, saçboyaları, vb. imalatı Tehlikeli
20.5 Diğer kimyasal ürünlerinimalatı
20.51 Patlayıcı madde imalatı
20.51.21 Barut, vb. itici tozlarınimalatı Çok Tehlikeli
20.51.22 Hazır patlayıcılar, emniyetfitilleri, çarpma kapsülleri,infilak fitilleri, ateşleyiciler,dinamit, elektrikli kapsüller,havai fişekler, sis işaretleri,işaret fişekleri, vb. patlayıcıveya piroteknik malzeme imalatı(barut hariç) Çok Tehlikeli
20.51.23 Kibrit imalatı Çok Tehlikeli
20.52 Tutkal imalatı
20.52.05 Tutkal imalatı (kazein esaslı,hayvansal esaslı, nişasta esaslı,kauçuk esaslı, plastik esaslı,polimer esaslı vb. olanlar) Çok Tehlikeli
20.53 Uçucu yağların imalatı/td>
20.53.02 Uçucu yağların imalatı Tehlikeli
20.59 Başka yerde sınıflandırılmamışdiğer kimyasal ürünlerinimalatı
20.59.01 Fotografik levha ve filmlerin(hassaslaştırılmış, ışığa maruzkalmamış olanlar), anındabaskılanan filmlerin,fotoğrafçılıkta kullanılan kimyasalmüstahzarların ve karışımsız (saf)ürünlerin imalatı Çok Tehlikeli
20.59.03 Aktif karbon imalatı Çok Tehlikeli
20.59.04 Yağlama müstahzarları (hidrolikfren sıvıları dahil), vuruntuönleyici müstahzarlar ile katkımaddeleri ve antifrizlerinimalatı Çok Tehlikeli
20.59.05 Yazım ve çizim mürekkepleri vediğer mürekkeplerin imalatı (matbaamürekkebi imalatı hariç) Tehlikeli
20.59.06 Peptonlar, diğer proteinmaddeleri ve bunların türevlerininve deri tozlarının imalatı Tehlikeli
20.59.07 Laboratuvar için hazır kültürortamları, model hamurları,kompozit diyagnostik reaktiflerveya laboratuvar reaktifleriimalatı Çok Tehlikeli
20.59.08 Elektronikte kullanılan macunkıvamında (dope edilmiş) olankimyasal elementler ilebileşiklerin imalatı Çok Tehlikeli
20.59.09 Bitirme (apreleme dahil)maddeleri, boya hammaddesi vebenzeri ürünlerin sabitlenmesiniveya boyayıcılığını hızlandıranboya taşıyıcı maddelerinimalatı Çok Tehlikeli
20.59.10 Dekapaj (temizleme)müstahzarları, eritkenler, hazırvulkanizasyon hızlandırıcımaddeler, kauçuk veya plastikleriçin plastikleştirici bileşikler vestabilizatörler, başka yerdesınıflandırılmamış katalitikmüstahzarlar imalatı Çok Tehlikeli
20.59.11 Jelatin ve jelatin türevleriile süt albüminlerinin imalatı Çok Tehlikeli
20.59.12 Kimyasal olarak değiştirilmişveya yenilemeyen hayvansal veyabitkisel katı ve sıvı yağlar ve yağkarışımlarının imalatı (linoksin,teknik ve sanayi amaçlı bitkiselsabit sıvı yağlar, sanayidekullanılan sıvı yağlar, vb.) Tehlikeli
20.59.13 Biyodizel, vb. biyoyakıtimalatı (bitkisel veya hayvansalyağlardan elde edilen uzun zincirliyağ asitlerinin mono alkilesterleri) (%70 veya daha fazlapetrol yağı ile karıştırılmışbiyodizelden ürünler hariç) Çok Tehlikeli
20.59.14 Başka yerde sınıflandırılmamışdiğer kimyasal ürünlerin imalatı(vakum tüpleri için emiciler,pirolinyitler, kazan taşı önleyicibileşikler, yağemülsiyonlaştırıcıları,dökümhanelerde kullanılan yardımcıkimyasal ürünler ve hazırbağlayıcılar, vb.) Çok Tehlikeli
20.59.15 Yangın söndürücü müstahzarlarıve dolum malzemeleri imalatı Çok Tehlikeli
20.6 Suni veya sentetik elyafimalatı
20.60 Suni veya sentetik elyafimalatı
20.60.01 Kardelenmemiş ve taranmamışsuni ve sentetik elyaf imalatı Çok Tehlikeli
20.60.02 Sentetik filament ipliği vesentetik monofilamentlerin,şeritlerin ve benzerlerinin imalatı(poliamidden ve polyesterden yüksekmukavemetli filament ipliklerdahil) (bükülü, katlı ve tekstürizeolanlar hariç) Tehlikeli
21 Temel eczacılık ürünlerinin veeczacılığa ilişkin malzemelerinimalatı
21.1 Temel eczacılık ürünleriimalatı
21.10 Temel eczacılık ürünleriimalatı
21.10.01 Temel eczacılık ürünlerininimalatı (antibiyotik, vitamin,salisilik asit gibi ilaçlarınimalatında farmakolojiközelliklerinden yararlanmak üzeretıbbi olarak etken maddeler ile kanürünlerinin, salgı bezi veekstrelerin, hormonların vb.imalatı) Çok Tehlikeli
21.2 Eczacılığa ilişkin ilaçlarınimalatı
21.20 Eczacılığa ilişkin ilaçlarınimalatı
21.20.01 Eczacılığa ilişkin tıbbiilaçların imalatı (antibiyotikiçeren tıbbi ilaçlar, ağrıkesiciler, hormon içeren tıbbiilaçlar vb.) Tehlikeli
21.20.02 Yapışkanlı bandajlar, katkütlerve benzeri tıbbi malzemelerinüretimi (steril cerrahi katgütler,eczacılık maddeleri ile birliktekullanılan tamponlar, hidrofilpamuk, gazlı bez, sargı bezivb.) Tehlikeli
21.20.03 Hayvan sağlığına ilişkin tıbbiilaçların imalatı Tehlikeli
21.20.04 Diğer eczacılıkmüstahzarlarının imalatı(antiserumlar, panzehirler, aşılar,hormon ve spermisit esaslı kimyasalkontraseptik müstahzarlar,diyagnostik reaktifleri ve diğereczacılık müstahzarları) (hayvansağlığı için olanlar dahil) Tehlikeli
22 Kauçuk ve plastik ürünlerinimalatı
22.1 Kauçuk ürünlerin imalatı
22.11 İç ve dış lastik imalatı;lastiğe sırt geçirilmesi ve yenidenişlenmesi
22.11.17 Kauçuktan iç lastiklerinimalatı (dış lastikler içindeğişebilir sırtlar, kolonlar veşeritlerin imalatı dahil) Çok Tehlikeli
22.11.18 Kauçuktan dış lastik imalatı(motosikletler, bisikletler,otomobiller, otobüsler, kamyonlar,hava taşıtları, traktörler ve diğeraraç ve donanımlar için) (dolguveya alçak basınçlı lastiklerdahil) Çok Tehlikeli
22.11.19 Lastik tekerleklerinin yenidenişlenmesi ve sırt geçirilmesi(lastiğin kaplanması) Çok Tehlikeli
22.19 Diğer kauçuk ürünleriimalatı
22.19.01 Kauçuktan hijyenik ve eczacılıkürünlerinin imalatı(prezervatifler, emzikler, hijyenikeldivenler vb. dahil) Tehlikeli
22.19.02 Kauçuktan tüp, boru vehortumların imalatı (vulkanizekauçuktan) Tehlikeli
22.19.03 Kauçuktan giyim eşyası ve giysiaksesuarlarının imalatı (giysiler,eldivenler vb.) Tehlikeli
22.19.04 Kauçuktan süpürgelerin vefırçaların imalatı Tehlikeli
22.19.05 Kauçuk ayakkabı/bot tabanlarıve ayakkabı/botların diğer kauçukparçalarının imalatı Tehlikeli
22.19.06 Kauçuktan yer döşemeleri vepaspasların imalatı Tehlikeli
22.19.07 Kauçuk kaplanmış, emdirilmiş,sıvanmış ve lamine edilmiş tekstilkumaşlarının imalatı, ana bileşenikauçuk olanlar (kord bezihariç) Tehlikeli
22.19.08 Kauçuktan paket lastiği, tütünkesesi, cam silecekleri, tarihıstampaları için karakterler,tapalar, lavabo pompaları, şişeleriçin tıpa ve halkalar ile sertkauçuktan diğer çeşitli eşyalarınimalatı Tehlikeli
22.19.09 Kauçuktan konveyör bantları vetaşıma kayışlarının imalatı Tehlikeli
22.19.10 Rejenere kauçuk imalatı,birincil formda veya levha, tabakaveya şerit halinde Tehlikeli
22.19.12 Kauçuktan silgi, rondela,conta, tekne veya iskeleusturmaçaları, gözenekli vulkanizekauçuktan teknik işlerde kullanılandiğer eşyalar ile demiryolu, karayolu taşıtları ve diğer araçlariçin kalıplanmış parçalarınimalatı Tehlikeli
22.19.13 Vulkanize edilmiş (kükürtlesertleştirilmiş) kauçuk imalatı(ip, kordon, levha, tabaka, şerit,çubuk ve profil halinde) Tehlikeli
22.2 Plastik ürünlerin imalatı /td>
22.21 Plastik tabaka, levha, tüp veprofil imalatı
22.21.03 Plastikten mamul halde tüp,boru, hortum ve bunların bağlantıelemanlarının imalatı (sunibağırsaklar dahil) Tehlikeli
22.21.04 Plastikten yarı mamul haldeprofil, çubuk, tabaka, levha, blok,film, folyo, şerit, vb. ilemonofilament imalatı (naylonbrandalar dahil) Tehlikeli
22.22 Plastik torba, çanta, poşet,çuval, kutu, damacana, şişe, makaravb. paketleme malzemelerininimalatı
22.22.43 Plastik poşet, çöp torbası,çanta, torba, çuval, file, sandık,kutu, kasa, damacana, şişe, bidon,makara, masura, bobin, tıpa, kapak,kapsül vb. paketleme malzemelerininimalatı (idrar torbası dahil) Tehlikeli
22.23 Plastik inşaat malzemesiimalatı
22.23.03 Plastikten depo, tank, fıçı vebenzeri kapların imalatı Tehlikeli
22.23.04 Plastikten prefabrik yapılarınimalatı Tehlikeli
22.23.05 Vinil, linolyum (muşamba) gibiesnek yer kaplamaları ile plastikzemin, duvar ve tavankaplamalarının imalatı (duvarkağıdı hariç) Tehlikeli
22.23.06 Plastikten merdiven, merdivenkorkuluğu, panjur, güneşlik,jaluzi, stor, vb. eşya ile bunlarınparçalarının imalatı Tehlikeli
22.23.07 Plastikten banyo küvetleri,lavabolar, klozet kapakları,oturakları ve rezervuarları ilebenzeri sıhhi ürünlerin imalatı(kalıcı tesisat için kullanılanmontaj ve bağlantı parçalarıdahil) Tehlikeli
22.23.08 Plastikten/PVC’den kapı,pencere, bunların kasaları,pervazları, kapı eşikleri, vb.imalatı Tehlikeli
22.23.90 Başka yerde sınıflandırılmamışplastik inşaat malzemelerininimalatı (plastik suni taş-mermeritimalatı) Tehlikeli
22.29 Diğer plastik ürünlerinimalatı
22.29.01 Plastikten sofra, mutfak,banyoda kullanılan eşya (silikonkek kalıbı, leğen, tas, kova vb.)ve diğer ev eşyası imalatı Tehlikeli
22.29.02 Plastikten dikişsiz giyimeşyası ve giysi aksesuarlarınınimalatı (eldiven dahil) Tehlikeli
22.29.03 Plastikten büro ve okulmalzemelerinin imalatı Tehlikeli
22.29.04 Ayakkabı ve terliklerin plastikparçalarının imalatı (plastikayakkabı kalıbı imalatı dahil) Tehlikeli
22.29.05 Makine, mobilya, kaporta, elaletleri ve benzerlerininplastikten bağlantı parçaları,plastikten taşıyıcı bantların vekonveyör bantlarının imalatı Tehlikeli
22.29.06 Plastik başlık (koruma amaçlıolanlar hariç), izolasyon bağlantıparçaları ile lambaların,aydınlatma ekipmanlarının, ışıklıtabelaların, vb.nin başka yerdesınıflandırılmamış plastikkısımlarının imalatı Tehlikeli
22.29.07 Plastikten mandal, askı,sünger, sabunluk, tarak, bigudi,toka, saç firketesi, boncuk, biblo,heykelcik ve diğer eşyalar ilemamul haldeki kendinden yapışkanlılevha, şerit vb. ürünlerinimalatı Tehlikeli
22.29.90 Başka yerde sınıflandırılmamışdiğer plastik ürünlerinimalatı Tehlikeli
23 Diğer metalik olmayan mineralürünlerin imalatı
23.1 Cam ve cam ürünleriimalatı
23.11 Düz cam imalatı
23.11.01 Levha veya tabaka halinde düzcam imalatı (telli, buzlu cam,renkli veya boyalı düz cam dahil)(dökülmüş, haddelenmiş, çekilmiş,üflenmiş, float, yüzeyi parlatılmışveya cilalanmış ancak başka şekildeişlenmemiş olanlar) Çok Tehlikeli
23.12 Düz camın şekillendirilmesi veişlenmesi
23.12.01 Cam ayna imalatı (taşıtlar içindikiz aynaları dahil) Çok Tehlikeli
23.12.02 Sertleştirilmiş emniyet camı vetemperli düz cam imalatı (oto camıdahil) Çok Tehlikeli
23.12.03 Çok katlı yalıtım camlarıimalatı Çok Tehlikeli
23.12.04 Levha veya tabaka halindeişlenmiş cam imalatı(kavislendirilmiş, kenarlarıişlenmiş, gravür yapılmış,delinmiş, emaylanmış/sırlanmış veyabaşka bir şekilde işlenmiş, fakatçerçevelenmemiş veya monteedilmemiş olanlar) (optik camlardahil) Çok Tehlikeli
23.13 Çukur cam imalatı
23.13.01 Camdan şişe, kavanoz ve diğermuhafaza kapları, bardaklar, termosve diğer vakumlu kapların camdanyapılmış iç yüzeyleri ile camdansofra ve mutfak eşyaları imalatı(ampuller hariç) Çok Tehlikeli
23.13.02 Tuvalet, banyo, büro, içdekorasyon, vb. amaçlarlakullanılan cam ve kristal eşyaimalatı (camdan biblo, boncuk vb.küçük cam eşyalar hariç) Çok Tehlikeli
23.14 Cam elyafı imalatı
23.14.01 Cam elyafı imalatı (cam yünü vebunlardan yapılmış dokuma dışıürünler dahil) Çok Tehlikeli
23.19 Diğer camların imalatı veişlenmesi (teknik amaçlı cameşyalar dahil)
23.19.01 Sıkıştırılmış veya kalıplanmışcamdan döşeme blokları, tuğlalar,karolar ve diğer ürünler, kurşunlulambalar ve benzerleri, blok, plakaveya benzer şekillerdeki gözenekli,köpüklü camların imalatı (vitraycam hariç) Tehlikeli
23.19.02 Duvar saati, kol saati veyagözlük için camlar (bombeli,kavisli, içi oyuk vb. şekildefakat, optik açıdan işlenmemiş) ilebu tür camların imalatı içinkullanılan içi boş küre ve bunlarınparçalarının imalatı Tehlikeli
23.19.03 Cam zarflar (açık) ve bunlarıncam parçalarının imalatı (elektrikampulleri, elektrik lambaları,katot-ışınlı tüpler vb. içinkullanılan) Tehlikeli
23.19.04 Küçük cam eşya imalatı (biblo,vb. süs eşyası, boncuklar,imitasyon inciler/taşlar, imitasyonmücevherler, vb. dahil) Tehlikeli
23.19.05 Lamba ve aydınlatmateçhizatının, ışıklı işaretlerin,isim tabelalarının vb.nin camparçalarının imalatı (camtabelaların imalatı dahil) Tehlikeli
23.19.06 Laboratuvar, hijyen veyaeczacılık ile ilgili cam eşyalarile cam ampullerin (serumampulleri) imalatı (ambalajlama vetaşımada kullanılanlar hariç) Tehlikeli
23.19.07 Camdan elektrik izolasyonmalzemesi imalatı Tehlikeli
23.19.08 Vitray cam imalatı Çok Tehlikeli
23.19.90 Başka yerde sınıflandırılmamışdiğer cam ürünlerin imalatı veişlenmesi (düz camdan yapılmışakvaryumların imalatı dahil) Tehlikeli
23.2 Ateşe dayanıklı (refrakter)ürünlerin imalatı
23.20 Ateşe dayanıklı (refrakter)ürünlerin imalatı
23.20.16 Silisli süzme topraktan(kizelgur) ısı yalıtımlı seramikürünler ile ateşe dayanıklı briket,blok, tuğla, ateş tuğlası, vb.ateşe dayanıklı seramik yapıürünleri imalatı Çok Tehlikeli
23.20.17 Ateşe dayanıklı imbikler,damıtma kabı, eritme potası, vanaucu, tüp, boru, döküm potaları,mufl ocağı, püskürtme tüpleri vb.seramik ürünlerin imalatı Çok Tehlikeli
23.20.18 Ateşe dayanıklı çimento, çamur,harç, beton vb. imalatı Çok Tehlikeli
23.3 Kilden inşaat malzemeleriimalatı
23.31 Seramik karo ve kaldırımtaşları imalatı
23.31.01 Seramik karo ve kaldırım taşıimalatı (mozaik taşı ve mozaikküpleri dahil) (ateşe dayanıklıolanlar hariç) Çok Tehlikeli
23.32 Fırınlanmış kilden tuğla, karove inşaat malzemeleri imalatı
23.32.01 Fırınlanmış, ateşe dayanıklıolmayan kil ve topraktan bacakünkleri ve başlıkları, şömine vebaca boruları, oluklar ve bağlantıparçaları ile tuğla, kiremit, karovb. inşaat malzemeleri imalatı(seramikten oluklar, borular vebağlantı parçaları dahil) Çok Tehlikeli
23.4 Diğer porselen ve seramikürünlerin imalatı
23.41 Seramik ev ve süs eşyalarıimalatı
23.41.01 Seramik veya porselenden sofratakımları (tabak, bardak, fincan,vb.) ve diğer ev ve tuvaleteşyasının imalatı (çiniden olanlarve sıhhi ürünler hariç) Çok Tehlikeli
23.41.02 Seramik ve porselendenheykelcik, vazo, biblo, vb. süseşyası imalatı (oyuncaklarhariç) Çok Tehlikeli
23.41.03 Çiniden sofra takımı, ev,tuvalet ve süs eşyası imalatı(çinicilik) (çini dekorudahil) Çok Tehlikeli
23.41.04 Topraktan güveç, çanak, çömlek,küp, vazo, vb. eşyalar iletopraktan heykel vb. süs vedekoratif eşya imalatı (porselen veçiniden olanlar ile mallarınambalajlanması ve taşınması içinolanlar hariç) Tehlikeli
23.42 Seramik sıhhi ürünlerinimalatı
23.42.01 Seramik sıhhi ürünlerinimalatı Çok Tehlikeli
23.43 Seramik yalıtkanların(izolatörlerin) ve yalıtkanbağlantı parçalarının imalatı
23.43.01 Seramik yalıtkanların(izolatörlerin) ve yalıtkanbağlantı parçalarının imalatı Çok Tehlikeli
23.44 Diğer teknik seramik ürünlerinimalatı
23.44.01 Diğer teknik seramik ürünlerinimalatı (laboratuvar, kimyasal vediğer teknik alanlarda kullanılanseramikten ürünler) (ateşedayanıklı seramik ürünlerhariç) Çok Tehlikeli
23.49 Başka yerde sınıflandırılmamışdiğer seramik ürünlerinimalatı
23.49.01 Tarımsal amaçlı olanlar ilemalların taşınması ya daambalajlanması için kullanılanseramik ürünlerin imalatı (seramikçömlekler, kavanozlar, vb. ileyalaklar, tekneler vb.) Çok Tehlikeli
23.49.02 Başka yerde sınıflandırılmamışyapı işlerinde kullanılmayan diğerseramik eşyaların imalatı(dekoratif amaçlı olmayan seramiksaksılar dahil) Çok Tehlikeli
23.5 Çimento, kireç ve alçıimalatı
23.51 Çimento imalatı
23.51.01 Çimento imalatı (çimentoklinkeri, portland, alüminyumluçimento (boksit çimentosu), cürufçimento, süper fosfat çimentolar vebenzeri suya dayanıklıçimentolar) Çok Tehlikeli
23.52 Kireç ve alçı imalatı
23.52.01 Sönmemiş kireç, sönmüş kireç vesuya dayanıklı kireç imalatı Çok Tehlikeli
23.52.02 Sönmüş alçıtaşından ya dasönmüş sülfattan alçı imalatı Çok Tehlikeli
23.52.03 Yanmış (kalsine edilmiş) veyaaglomera edilmiş dolomitimalatı Çok Tehlikeli
23.6 Beton, çimento ve alçıdanyapılmış eşyaların imalatı
23.61 İnşaat amaçlı beton ürünlerinimalatı
23.61.01 Çimentodan, betondan veya sunitaştan prefabrik yapı elemanlarıimalatı (gaz betondan ve kireçtaşından olanlar dahil) Tehlikeli
23.61.02 Çimentodan, betondan veya sunitaştan karo, döşeme taşı, kiremit,tuğla, boru, vb. inşaat amaçlıürünlerin imalatı Tehlikeli
23.61.03 Betondan yapılmış prefabrikyapıların imalatı Tehlikeli
23.62 İnşaat amaçlı alçı ürünlerinimalatı
23.62.01 İnşaat amaçlı alçı ürünlerinimalatı (kartonpiyer, levhalar,panolar, paneller, vb.) Tehlikeli
23.63 Hazır beton imalatı
23.63.01 Hazır beton imalatı Tehlikeli
23.64 Toz harç imalatı
23.64.01 Toz harç imalatı Tehlikeli
23.65 Lif ve çimento karışımlıürünlerin imalatı
23.65.02 Lif ve çimento karışımlıürünlerin imalatı Tehlikeli
23.69 Beton, alçı ve çimentodanyapılmış diğer ürünlerinimalatı
23.69.01 Başka yerde sınıflandırılmamışalçı ve alçı esaslı bileşenlerdenürünlerin imalatı Tehlikeli
23.69.02 Beton, çimento ya da sunitaştan yapılmış diğer ürünlerinimalatı (heykel, alçak ve yüksekkabartma, vazo, çiçek saksısı,mimari süsler, bahçe süsleri,vb.) Tehlikeli
23.7 Taş ve mermerin kesilmesi,şekil verilmesi ve bitirilmesi
23.70 Taş ve mermerin kesilmesi,şekil verilmesi ve bitirilmesi
23.70.01 Taş ve mermerin kesilmesi,şekil verilmesi ve bitirilmesi(doğal taşlardan, mermerden, sumermerinden, travertenden,kayağantaşından levha/tabaka,kurna, lavabo, karo, kaldırım taşı,yapı taşı, mezar taşı, vb. imalatıdahil, süs eşyası hariç) Çok Tehlikeli
23.70.02 Doğal taşlardan, mermerden, sumermerinden, travertenden,kayağantaşından süs eşyası imalatı(lületaşı, kehribar, vb.ndenolanlar dahil) Tehlikeli
23.9 Aşındırıcı ürünlerin ve başkayerde sınıflandırılmamış metalikolmayan mineral ürünlerinimalatı
23.91 Aşındırıcı ürünlerinimalatı
23.91.01 Aşındırıcı ürünlerin imalatı(değirmen taşları, bileği taşı,zımpara kağıdı, vb.) Çok Tehlikeli
23.99 Başka yerde sınıflandırılmamışmetalik olmayan diğer mineralürünlerin imalatı
23.99.01 Asfalttan ve benzerimalzemelerden yapılan ürünlerinimalatı (çatı yapımında veya suyalıtımında kullanılan bitüm esaslıkeçeler dahil) Çok Tehlikeli
23.99.02 Mineral ses/ısı izolasyonmalzemelerinin imalatı (cürufyünleri, taş yünü, madeni yünler,pul pul ayrılmış vermikulit,genleştirilmiş kil, soğuk tandişplakası, vb. ısı ve ses yalıtımmalzemeleri) Çok Tehlikeli
23.99.03 İşlenmiş asbest (amyant)lifleri, asbest ve magnezyumkarbonat esaslı karışımlar, bukarışımlardan veya asbesttenyapılan ürünler, fren, debriyaj vebenzerleri için monte edilmemişsürtünme malzemeleri (fren balatasıvb.) imalatı Çok Tehlikeli *
23.99.04 İşlenmiş mika ve mikadanürünlerin imalatı Çok Tehlikeli
23.99.05 Bitümlü karışımların imalatı(doğal veya suni taştan malzemelerile bir bağlayıcı olarak bitüm,doğal asfalt veya ilgili maddelerinkarıştırılmasıyla eldeedilenler) Çok Tehlikeli *
23.99.07 Amyantlı kağıt imalatı Çok Tehlikeli *
23.99.09 Suni korindon imalatı Çok Tehlikeli
23.99.90 Diğer metal dışı minerallerden(turbadan, grafitten, vb. monteedilmemiş) ürünlerin imalatı(karbon elyafı dahil, elektrikamaçlı olanlar hariç) Çok Tehlikeli
24 Ana metal sanayii
24.1 Ana demir ve çelik ürünleri ileferro alaşımların imalatı
24.10 Ana demir ve çelik ürünleri ileferro alaşımların imalatı
24.10.01 Ham çelik üretilmesi (kütükveya diğer birincil formlarda ya dayarı mamul çelik ürünlerhalinde) Çok Tehlikeli
24.10.02 Çelikten açık profil imalatı(sıcak haddeleme, sıcak çekme veyakalıptan çekme işlemlerinden dahaileri işlem görmemiş) Çok Tehlikeli
24.10.03 Demir ve çelikten sıcak veyasoğuk çekilmiş yassı hadde ürünleriimalatı (demir veya çelik alaşımlılevha, şerit, sac, teneke sac, vb.dahil) Çok Tehlikeli
24.10.05 Sıcak haddelenmiş demir veyaçelikten bar ve çubuklarınüretilmesi (inşaat demiridahil) Çok Tehlikeli
24.10.06 Demir veya çelik granül vedemir tozu üretilmesi Çok Tehlikeli
24.10.07 Demir ya da çelik hurdalarınyeniden eritilmesi Çok Tehlikeli
24.10.08 Demir cevherinin doğrudanindirgenmesiyle elde edilen demirliürünler ve diğer sünger demirürünlerinin imalatı ile elektrolizveya diğer kimyasal yöntemlerleistisnai saflıkta demirüretilmesi Çok Tehlikeli
24.10.09 Çelikten demir yolu ve tramvayyolu yapım malzemesi(birleştirilmemiş raylar ile raydonanımı, aksamı, vb.) ile levhakazıkları (palplanş) ve kaynaklıaçık profil imalatı Çok Tehlikeli
24.10.10 Pik demir ve manganezli dökmedemir (aynalı demir/spiegeleisen)üretimi (külçe, blok, veya diğerbirincil formlarda) Çok Tehlikeli
24.10.12 Ferro alaşımların imalatı(ferro manganez, ferro silisyum,ferro siliko manganez, ferro kromve diğerleri) Çok Tehlikeli
24.2 Çelikten tüpler, borular, içiboş profiller ve benzeri bağlantıparçalarının imalatı
24.20 Çelikten tüpler, borular, içiboş profiller ve benzeri bağlantıparçalarının imalatı
24.20.09 Çelikten/demirden yapılmış tüp,boru, içi boş profiller ve ilgilibağlantı parçalarının imalatı(sıcak çekilmiş veya sıcakhaddelenmiş) Çok tehlikeli
24.20.10 Çelikten/demirden yapılmış tüp,boru, içi boş profiller ve ilgilibağlantı parçalarının imalatı(soğuk çekilmiş veya soğukhaddelenmiş) Tehlikeli
24.3 Çeliğin ilk işlenmesinde eldeedilen diğer ürünlerin imalatı
24.31 Barların soğuk çekilmesi
24.31.01 Çelik barların ve içi doluprofillerin soğuk çekme yöntemiyleimalatı Tehlikeli
24.32 Dar şeritlerin soğukhaddelenmesi
24.32.01 Çelik dar şeritlerin soğukhadde yöntemiyle imalatı (genişliği< 600 mm olan) Tehlikeli
24.33 Soğuk şekillendirme veyakatlama
24.33.01 Açık profillerin, nervürlülevhaların ve sandviç panellerinsoğuk şekillendirme veya katlamayöntemiyle imalatı Tehlikeli
24.34 Tellerin soğuk çekilmesi
24.34.01 Çelik tellerin soğuk çekmeyöntemiyle imalatı Tehlikeli
24.4 Değerli ana metaller ve diğerdemir dışı metallerin imalatı
24.41 Değerli metal üretimi
24.41.16 Altın imalatı (işlenmemiş, yarıişlenmiş, toz halde) ile gümüş veyaadi metallerin altınla kaplanmasıveya giydirilmesi Çok Tehlikeli
24.41.17 Gümüş imalatı (işlenmemiş, yarıişlenmiş, toz halde) ile adimetallerin gümüşlegiydirilmesi Çok Tehlikeli
24.41.18 Platin imalatı (işlenmemiş,yarı işlenmiş, toz halde) ilealtın, gümüş veya adi metallerinplatinle kaplanması veyagiydirilmesi (paladyum, rodyum,osmiyum ve rutenyum imalatı ileplatin katalizör imalatıdahil) Çok Tehlikeli
24.41.19 Değerli metal alaşımlarınınimalatı Çok Tehlikeli
24.42 Alüminyum üretimi
24.42.16 Alüminyum folyo imalatı(alaşımdan olanlar dahil) Tehlikeli
24.42.17 Alüminyum imalatı (işlenmemişhalde) Çok Tehlikeli
24.42.18 Alüminyum sac, levha, tabaka,şerit imalatı (alaşımdan olanlardahil) Tehlikeli
24.42.20 Alüminyum oksit imalatı (sunikorindon hariç) (alümina) Çok Tehlikeli
24.42.21 Alüminyum bar, çubuk, tel veprofil, tüp, boru ve bağlantıparçaları imalatı (alaşımdanolanlar dahil) Tehlikeli
24.43 Kurşun, çinko ve kalayüretimi
24.43.01 Kurşun tabaka, levha, şerit,folyo, kurşun tozu ve pulu imalatı(alaşımdan olanlar dahil) Çok Tehlikeli
24.43.02 Kurşun imalatı(işlenmemiş) Çok Tehlikeli
24.43.04 Kalay bar, çubuk, profil, tel,vb. imalatı (alaşımdan olanlardahil) Çok Tehlikeli
24.43.05 Kalay imalatı (işlenmemişhalde) Çok Tehlikeli
24.43.06 Çinko imalatı (işlenmemişhalde) Çok Tehlikeli
24.43.07 Çinko bar, çubuk, profil, telvb. imalatı (alaşımdan olanlardahil) Tehlikeli
24.43.08 Çinko sac, tabaka, levha,şerit, folyo, çinko tozları, vb.imalatı (alaşımdan olanlardahil) Tehlikeli
24.44 Bakır üretimi
24.44.01 Bakır, bakır matı, bakır tozu,semente bakır, bakır anotu ilebakır ve bakır alaşımlarınınimalatı Çok Tehlikeli
24.44.03 Bakır sac, tabaka, levha,şerit, folyo imalatı (alaşımdanolanlar dahil) Tehlikeli
24.44.04 Bakırın çekilmesi vehaddelenmesi ile tüp, boru,bunların bağlantı elemanları, bar,çubuk, tel ve profil imalatı(alaşımdan olanlar dahil) Tehlikeli
24.45 Demir dışı diğer metallerinüretimi
24.45.01 Maden cevherlerinden ya daoksitlerden işlenmemiş krom,manganez, nikel, tungsten,molibden, tantalum, kobalt, bizmut,titanyum, zirkonyum, berilyum,germanyum vb. imalatı (alaşımlarıdahil) Çok Tehlikeli
24.45.02 Krom, manganez, tungsten,molibden, tantalum, kobalt, bizmut,titanyum, zirkonyum, berilyum,germanyum vb. demir dışımetallerden yapılan ürünlerinimalatı (sermetler ve diğer araürünler dahil, nikelden olanlarhariç) Çok Tehlikeli
24.45.06 Nikel matları, nikel oksitsinterleri ve diğer ara ürünleriile nikel bar, çubuk, profil, tel,levha, şerit, folyo, tüp, boru vebağlantı parçaları imalatı Çok Tehlikeli
24.46 Nükleer yakıtlarınişlenmesi
24.46.01 Uranyum ve radyumlu madencevherlerinden veya diğercevherlerden metalik uranyumüretimi, uranyumun ergitilmesi verafine edilmesi (zenginleştirilmişplutonyum, uranyum, toryum ilebunların bileşiklerinin imalatıhariç) Çok Tehlikeli
24.5 Metal döküm sanayii
24.51 Demir döküm
24.51.13 Demir döküm (yarı mamul demirürünlerin dökümü, gri demir dökümü,küresel grafit demir dökümü,dövülebilir dökme demir ürünleridökümü, tüpler, borular ve içi boşprofiller ile dökme demirden tüp veborular ile bunların bağlantıparçalarının imalatı) Çok Tehlikeli
24.52 Çelik dökümü
24.52.20 Çelik dökümü Çok Tehlikeli
24.53 Hafif metallerin dökümü
24.53.01 Hafif metallerin dökümü(alüminyum, magnezyum, titanyum,çinko vb.den yarı mamul ürünlerindökümü ile dökme hafif metallerindökümü) Çok Tehlikeli
24.54 Diğer demir dışı metallerindökümü
24.54.01 Demir dışı ağır metallerindökümü (bakır vb.) Çok Tehlikeli
24.54.02 Değerli metallerin dökümü Çok Tehlikeli
25 Fabrikasyon metal ürünleriimalatı (makine ve teçhizathariç)
25.1 Metal yapı malzemeleriimalatı
25.11 Metal yapı ve yapı parçalarıimalatı
25.11.06 Metalden yapı ve yapıparçalarının imalatı (kepenk veyangın merdiveni ile prefabrikyapılar hariç) Tehlikeli
25.11.07 Metalden kepenk ve yangınmerdiveni imalatı Tehlikeli
25.11.08 Metalden prefabrik yapıimalatı Tehlikeli
25.12 Metalden kapı ve pencereimalatı
25.12.04 Alüminyum kapı, pencere,bunların kasaları, kapı eşiği,panjur, vb. imalatı Tehlikeli
25.12.05 Çelik kapı, pencere, bunlarınkasaları, kapı eşiği, panjur, vb.imalatı Tehlikeli
25.12.06 Demir kapı, pencere, bunlarınkasaları, kapı eşiği, panjur, vb.imalatı (bahçe kapıları dahil) Tehlikeli
25.2 Metal tank, rezervuar vemuhafaza kapları imalatı
25.21 Merkezi ısıtma radyatörleri(elektrikli radyatörler hariç) vesıcak su kazanları (boylerleri)imalatı
25.21.10 Merkezi ısıtma radyatörleriimalatı (elektrikli radyatörler iledöküm olanlar hariç) Tehlikeli
25.21.11 Merkezi ısıtma kazanları(boyler) imalatı (kombi, katkaloriferi ve diğer merkezi ısıtmakazanları) (buhar jeneratörleri vekızgın su üreten kazanlarhariç) Tehlikeli
25.21.12 Merkezi ısıtma radyatörleriimalatı, döküm olanlar (elektrikliradyatörler hariç) Çok Tehlikeli
25.29 Metalden diğer tank, rezervuarve konteynerler imalatı
25.29.01 Sıkıştırılmış veyasıvılaştırılmış gaz için kullanılanmetal konteynerlerin imalatı Tehlikeli
25.29.02 Metalden rezervuarlar, tanklar,fıçılar ve benzeri kapasitesi >300 litre olan konteynerlerinimalatı (sıkıştırılmış veyasıvılaştırılmış gazlar için olanlarile mekanik veya termal ekipmanlıolanlar hariç) Tehlikeli
25.3 Buhar jeneratörü imalatı,merkezi ısıtma sıcak su kazanları(boylerleri) hariç
25.30 Buhar jeneratörü imalatı,merkezi ısıtma sıcak su kazanları(boylerleri) hariç
25.30.01 Buhar üretim kazanları (buharjeneratörü), kızgın su kazanları(boyler) ve bunların parçaları ilekazanlar (boylerler) için yardımcıüniteler ve buhar veya diğer buhargüç üniteleri için kondansatörimalatı Tehlikeli
25.30.02 Nükleer reaktörler ve nükleerreaktör parçası imalatı (izotopayırıcılar hariç) Çok Tehlikeli
25.4 Silah ve mühimmat (cephane)imalatı
25.40 Silah ve mühimmat (cephane)imalatı
25.40.01 Tabanca, revolver (altıpatlar),av tüfeği, havalı tabanca, cop, vb.askeri amaçlı olmayan ateşlisilahlar ve benzeri aletlerin vebunların parçalarının imalatı Çok Tehlikeli
25.40.02 Askeri silah ve bunlarınparçalarının imalatı (büyük toplar,savaş araçları, füzeatarlar, torpilkovanları, ağır makineli tüfekler,vb.) Çok Tehlikeli
25.40.03 Bomba, füze ve benzeri savaşgereçleri, fişekler, diğer mermi vemühimmatlar ile bunlarınparçalarının imalatı Çok Tehlikeli
25.5 Metallerin dövülmesi,preslenmesi, baskılanması veyuvarlanması; toz metalürjisi
25.50 Metallerin dövülmesi,preslenmesi, baskılanması veyuvarlanması; toz metalürjisi
25.50.01 Metallerin dövülmesi,preslenmesi, baskılanması vedamgalanması Tehlikeli
25.50.02 Toz metalürjisi Çok Tehlikeli
25.6 Metallerin işlenmesi vekaplanması; makinede işleme
25.61 Metallerin işlenmesi vekaplanması
25.61.01 Metallerin ısıl işlem veanodlama, sertleştirme, vernikleme,vb. yüzey işlemleri, elektroliz,çinkoyla galvanizleme veya kimyasalişlemlerle metalik kaplama (kalayve nikel kaplama hariç) ve plastik,teflon, vb. metal dışı malzemelerlekaplama faaliyeti Çok Tehlikeli
25.61.02 Metallerin kalay ile kaplanması(kalaycılık) faaliyeti Çok Tehlikeli
25.61.03 Metallerin nikel ile kaplanması(nikelajcılık) faaliyeti Çok Tehlikeli
25.62 Metallerin makinede işlenmesive şekil verilmesi
25.62.01 Lazer ışınlarının, CNC oksijen,CNC plazma, CNC su jeti vb.makinelerinin kullanılması yoluylametallerin kesilmesi veyaüzerlerinin yazılması Tehlikeli
25.62.02 Metallerin makinede işlenmesi(torna tesfiye işleri, metalparçaları delme, tornalama,frezeleme, rendeleme, parlatma,oluk açma, perdahlama, birleştirme,kaynak yapma vb. faaliyetler) Tehlikeli
25.7 Çatal-bıçak takımı ve diğerkesici aletler ile el aletleri vegenel hırdavat malzemeleriimalatı
25.71 Çatal-bıçak takımları ve diğerkesici aletlerin imalatı
25.71.01 Kaşık, çatal, kepçe, kevgir,servis spatulası, şeker maşası vebenzeri mutfak gereçleri, sofratakımları, çatal bıçak takımlarıimalatı (balık bıçakları, kahvaltıve meyve bıçakları dahil fakat,sofra bıçakları hariç) Tehlikeli
25.71.02 Sofra bıçakları (balıkbıçakları, kahvaltı ve meyvebıçakları hariç), budama bıçakları,sustalı bıçaklar, satır, vb.bıçaklar (makineler için olanlarhariç) ile terzi makasları, vb.makaslar ve bunların ağızlarınınimalatı Tehlikeli
25.71.03 Kılıç, pala, kasatura, mızrak,süngü, avcı bıçağı ve benzerisilahlar ile bunların parçalarınınimalatı Tehlikeli
25.71.04 Manikür veya pedikür setleri vealetleri, kağıt bıçakları, mektupaçacakları, kalemtıraşlar vebunların bıçakları, kırma, yarma vekıyma bıçakları, saç kesme vehayvan kırkma makine ve aletleriile benzeri elektriksiz kesicialetlerin imalatı Tehlikeli
25.71.05 Tıraş bıçakları, usturalar ilejiletler ve tıraş makinelerininbıçaklarının imalatı Tehlikeli
25.72 Kilit ve menteşe imalatı
25.72.01 Asma kilit, kilit, anahtar,menteşe, otomatik kapıkapayıcıları, kilitli klipsler,bağlantı takozu, askılıklar,bulaşıklıklar, anahtar askıları,vb. ile binalar, mobilyalar,taşıtlar, vb. için küçüktekerleklerin imalatı Tehlikeli
25.73 El aletleri, takım tezgahıuçları, testere ağızları vb.imalatı
25.73.02 El aletleri, takım tezgahıuçları, testere ağızları,mengeneler, kıskaçlar, sıkıştırmaanahtarları vb. imalatı Tehlikeli
25.73.03 Metalden kalıp ve döküm modeliimalatı (kek ve ayakkabı kalıplarıhariç) Tehlikeli
25.73.04 Kuyumculuk aletleri veparçalarının imalatı (pense, keski,çekiç vb. aletler) Tehlikeli
25.73.05 Plastikten kalıp ve dökümmodeli imalatı (kek ve ayakkabıkalıpları hariç) Tehlikeli
25.73.06 Ahşap ve diğer malzemelerdenkalıp ve döküm modeli imalatı (kekve ayakkabı kalıpları hariç) Tehlikeli
25.9 Diğer fabrikasyon metalürünlerin imalatı
25.91 Çelik varil ve benzermuhafazaların imalatı
25.91.01 Çelik varil ve benzermuhafazaların imalatı Tehlikeli
25.92 Metalden hafif paketlememalzemeleri imalatı
25.92.01 Demir veya çelikten yiyecek,içecek ve diğer ürünler içinkapasitesi < 50 litre olankutuların imalatı (lehim veyakıvrılarak kapatılanlar) (tenekedenolanlar dahil) Tehlikeli
25.92.02 Adi metalden dişli kapaklar(şişe kapağı vb.) ve tıpalar iletıkaçlar ve kapakların imalatı Tehlikeli
25.92.03 Kapasitesi 300 lt.yi geçmeyenalüminyum varil fıçı, kova, kutu,vb. imalatı (diş macunu, krem gibikapaklı tüpler ve katlanabilirkutular ile aerosol kutularıdahil) Tehlikeli
25.93 Tel ürünleri, zincir veyayların imalatı
25.93.01 Metalden zincirler (mafsallıbağlantı zinciri hariç) veparçaları ile yay ve yayyaprakları, kaplanmış veya nüveliteller, çubuklar, tüpler, levhalarve elektrotların imalatı (elektrikişlerinde kullanılanlar ileelektrik yalıtımı olanlarhariç) Tehlikeli
25.93.02 İğne, çengelli iğne, çuvaldız,örgü şişi, tığ, raptiye, çivi, vb.imalatı Tehlikeli
25.93.03 Telden yapılan diğer ürünlerinimalatı (örgülü tel, örme şerit,taşıma askısı, dikenli tel(elektrik yalıtımı olanlar hariç)ve demir, çelik veya bakırtellerden mensucat, ızgara, ağ,kafeslik ve çitler) Tehlikeli
25.94 Bağlantı malzemelerinin ve vidamakinesi ürünlerinin imalatı
25.94.01 Yivsiz bağlantı malzemeleriimalatı, demir, çelik veya bakırdan(rondelalar, perçinler, perçinçivileri, kamalı pimler, kopilyalarvb. ürünler) Tehlikeli
25.94.02 Yivli bağlantı malzemeleriimalatı, demir, çelik veya bakırdan(vidalar, cıvatalar, somunlar vb.yivli ürünler) Tehlikeli
25.99 Başka yerde sınıflandırılmamışdiğer fabrikasyon metal ürünlerinimalatı
25.99.01 Demir, çelik ve alüminyumdansofra ve mutfak eşyalarının imalatı(tencere, tava, çaydanlık, cezve,yemek kapları, bulaşık telleri vb.)(teflon, emaye vb. ile kaplanmışlardahil, bakırdan olanlar hariç) Tehlikeli
25.99.02 Metalden yapılmış eviye,lavabo, küvet, duş teknesi, jakuzi(emaye olsun-olmasın) ve diğersıhhi ürünlerin imalatı Tehlikeli
25.99.03 Zırhlı veya güçlendirilmişkasalar, kasa daireleri, kilitlipara kasaları, zırhlı kapılar vb.imalatı (adi metalden) Tehlikeli
25.99.04 Adi metalden büro malzemeleriimalatı (dosya kutuları, kaşeler,zımba telleri, kağıt ataçlarıvb.) Tehlikeli
25.99.05 Metalden yapılmış çeşitlieşyaların imalatı (klips, tarak,saç tokası, saç firketesi, bigudi,kopça, elbise askısı, rozet, rütbe,kapan, tuzak, çöp sepeti, sigaratabakası, palet, makara, kanca,kozmetik kutuları vb.) (tekstilürünleri imalatında kullanılanlarhariç) Tehlikeli
25.99.06 Bakırdan sofra ve mutfak eşyasıimalatı (cezve, tencere, çanak,tabak, ibrik vb.) Tehlikeli
25.99.07 Kalıcı metalik mıknatıslarınimalatı Tehlikeli
25.99.08 Metalden gemi ve teknepervaneleri ve bunların aksamlarıile çıpalar, filika demirleri vb.imalatı Çok Tehlikeli
25.99.09 Alüminyum jaluzi perdeimalatı Tehlikeli
25.99.10 Metal merdiven imalatı Tehlikeli
25.99.11 Zil, çan, gong vb. eşyalar ileadi metallerden biblo, heykelcik,çerçeve, ayna ve diğer süs eşyasıimalatı (bisiklet zilleri dahilancak kalıba dökülerek yapılanlar,bakırdan olanlar ile mutfakeşyaları hariç) Tehlikeli
25.99.12 Kalıba dökülerek yapılan zil,çan, gong vb. eşyalar ile adimetallerden kalıba dökülerekyapılan biblo, heykelcik ve diğersüs eşyası imalatı (bisikletzilleri dahil ancak bakırdanolanlar ile mutfak eşyalarıhariç) Çok Tehlikeli
25.99.13 Metalden çatı olukları, çatıkaplamaları vb. imalatı Tehlikeli
25.99.14 Adi metallerden işaretlevhaları ve tabelalar ilerakamlar, harfler ve diğersembollerin imalatı (oto plakalarıdahil, ışıklı olanlar hariç) Tehlikeli
25.99.15 Kurşun tüp, boru ve bunlarınbağlantı parçaları ile kurşun bar,çubuk, profil, tel vb. imalatı(alaşımdan olanlar dahil) Çok Tehlikeli
25.99.16 Kalay plaka, tabaka, sac,levha, şerit, folyo, tüp, boru vekalay tozları ile diğer ürünlerinimalatı Tehlikeli
25.99.17 Çinko tüp, boru ve bağlantıparçaları ile diğer ürünlerinimalatı Tehlikeli
25.99.18 Bakırdan yapılan biblolar,çerçeveler, aynalar ve diğersüsleme eşyaları ile süsleme işleri(mutfak eşyaları hariç) Tehlikeli
25.99.19 Demir yolu veya tramvayhatlarında kullanılan adi metaldensabit malzemeler ve bağlantıparçaları ile bunların parçalarınınimalatı Tehlikeli
25.99.20 Elektriksiz sebze-meyve dilme,doğrama ve sularını çıkarmaaletleri, et kıyma aletleri, kahveve baharat değirmenleri, el havanı,rende vb. el gücüyle çalışan mutfakaletleri ve aksesuarlarıimalatı Tehlikeli
25.99.21 Elektriksiz hazneli dönerbacaların, havalandırmakanallarının vb. imalatı Tehlikeli
26 Bilgisayarların, elektronik veoptik ürünlerin imalatı
26.1 Elektronik bileşenlerin vedevre kartlarının imalatı
26.11 Elektronik bileşenlerinimalatı
26.11.04 Diyotların, transistörlerin,diyakların, triyaklar, tristör,rezistans, ledler, kristal, röle,mikro anahtar, sabit veyaayarlanabilir direnç vekondansatörler ile elektronikentegre devrelerin imalatı Tehlikeli
26.11.05 Katot ışınlı görüntü tüpleri,televizyon kamerası tüpleri vemagnetronlar, klistronlar,mikrodalga tüpleri ve diğer valftüplerinin, LCD ve plazma TVpanelleri ve göstergelerinimalatı Tehlikeli
26.11.06 Çıplak baskılı devrekartlarının imalatı Tehlikeli
26.11.90 Bys. diğer elektronikbileşenlerin imalatı Tehlikeli
26.12 Yüklü elektronik kartimalatı
26.12.01 Yüklü elektronik kart imalatı(yüklü baskılı devre kartları, ses,görüntü, denetleyici, ağ ve modemkartları ile akıllı kartlarvb.) Tehlikeli
26.2 Bilgisayar ve bilgisayar çevrebirimleri imalatı
26.20 Bilgisayar ve bilgisayar çevrebirimleri imalatı
26.20.01 Bilgisayar ve bilgisayar çevrebirimleri imalatı Tehlikeli
26.3 İletişim ekipmanlarınınimalatı
26.30 İletişim ekipmanlarınınimalatı
26.30.02 Radyo ve televizyon stüdyolarıve yayın teçhizatları ile radyo vetelevizyon iletim cihazlarınınimalatı (tv kameraları ve bazistasyonları dahil) Tehlikeli
26.30.03 Kızıl ötesi (enfraruj) sinyalkullanan iletişim cihazlarınınimalatı (örn: uzaktan kumandacihazları) Tehlikeli
26.30.05 Alıcı ve verici antenlerinimalatı (harici, teleskopik, çubuk,uydu, çanak ve hava ve deniztaşıtlarının antenleri) Tehlikeli
26.30.06 Kablolu ve kablosuz telefon,cep telefonu, kablolu görüntülütelefon, çağrı cihazı ve fakscihazı imalatı (telesekreterimalatı dahil) Tehlikeli
26.30.08 Merkezi iletişim santraldonanımları ile sayısal veya analogtelefon-telgraf santrallerinin veağ geçitleri, köprüleri,yönlendiricileri gibi veri iletimdonanımlarının imalatı (mors veyamors tipi kaydedici ve anahtarlardahil) Tehlikeli
26.30.09 Hırsız ve yangın alarmsistemleri ve kapı konuşmasistemlerinin (diyafon) (görüntülüolanlar dahil) imalatı (motorlukara taşıtları için alarmsistemleri hariç) Tehlikeli
26.30.10 Ses, görüntü veya diğerverilerin alınması, dönüştürülmesi,iletilmesi/yeniden oluşturulmasıiçin kullanılan diğer makinelerinimalatı (alıcısı/vericisi bulunantelgraf, teleks cihazları ileanahtarlama ve yönlendirmecihazları dahil) Tehlikeli
26.30.90 Başka yerde sınıflandırılmamışdiğer iletişim ekipmanlarınınimalatı Tehlikeli
26.4 Tüketici elektroniğiürünlerinin imalatı
26.40 Tüketici elektroniğiürünlerinin imalatı
26.40.08 Ses ve görüntü oynatıcı vekaydedicileri, ev tipi videokameralar ve diğer görüntü kayıtveya görüntü çoğaltma cihazlarınınimalatı Tehlikeli
26.40.09 Radyo ve televizyon imalatı(taşıtlarda kullanılanlardahil) Tehlikeli
26.40.10 Mikrofon, hoparlör vekulaklıklar ile elektrikli sesyükselteçlerinin (amplifikatörler)imalatı Tehlikeli
26.40.11 Monitörler ve projektörlerinimalatı (bilgisayar gibi birotomatik veri işleme sistemindekullanılmayanlar) Tehlikeli
26.40.12 Video oyun ve konsollarının(televizyonla kullanılanlar vekendi ekranı olanlar) imalatı Tehlikeli
26.40.90 Bys. tüketici elektroniğiürünlerinin imalatı Tehlikeli
26.5 Ölçme, test ve seyrüseferamaçlı alet ve cihazlar ile saatimalatı
26.51 Ölçme, test ve seyrüseferamaçlı alet ve cihazlarınimalatı
26.51.02 Dedektör imalatı (yeraltıkaynakları, maden, mayın, güvenlikkontrol, radyasyon vb.dedektörleri) Tehlikeli
26.51.03 Elektrik miktarını (volt, akımvb.) ölçmek ve kontrol etmek içinkullanılan alet ve cihazlarınimalatı (avometre, voltmetre,osiloskop ile diğer voltaj, akım,direnç veya elektrik gücünü ölçümveya kontrol için olanlar)(elektrik sayaçları hariç) Tehlikeli
26.51.04 Hız ve mesafe ölçümündekullanılan alet ve cihazlarınimalatı (taşıt hız göstergesi,takometre, taksimetre vb.) Tehlikeli
26.51.05 Isı ve sıcaklık ölçümündekullanılan alet ve cihazlarınimalatı (termometre, termostat,pirometre vb.) Tehlikeli
26.51.06 Işık, ışın ve renk ölçümündekullanılan alet ve cihazlarınimalatı (polarimetre, kolorimetre,refraktometre vb.) Tehlikeli
26.51.07 Meteorolojide kullanılan aletve cihazların imalatı Tehlikeli
26.51.08 Yön bulma pusulaları ile diğerseyrüsefer alet ve cihazlarının veradar cihazlarının imalatı (hava,kara ve deniz taşımacılığındakullanılanlar dahil) Tehlikeli
26.51.09 Hava, sıvı ve gazların akış,seviye, basınç veya diğerdeğişkenlerini ölçme ve kontroletme için kullanılan aletlerinimalatı (hidrometre, debimetre,barometre, higrometre vb.) Tehlikeli
26.51.10 Gaz, sıvı veya elektrik üretimveya tüketim sayaçlarınınimalatı Tehlikeli
26.51.11 Teçhizatlı çizim masaları vemakineleri ile diğer çizim,işaretleme veya matematikselhesaplama aletlerinin imalatı(pergel takımı, pantograf, resim,çizim, hesap yapmaya mahsuselektrikli/elektronik çiziciler vb.dahil) Tehlikeli
26.51.12 Laboratuvar, kuyumculuk vb.yerlerde kullanılan hassastartıların imalatı Tehlikeli
26.51.13 Sanayide kullanılan işlemkontrol amaçlı teçhizatlarınimalatı Tehlikeli
26.51.14 Telemetreler, teodolitler vediğer arazi ölçümü, hidrografik,oşinografik, hidrolojik veyajeofizik alet ve cihazlarınınimalatı Tehlikeli
26.51.15 Seyrüsefere yardımcı telsizcihazları ile uzaktan kumandalıkontrol cihazlarının (roketler,füzeler, makineler vb) imalatı Tehlikeli
26.51.90 Bys. ölçme, test ve seyrüseferamaçlı alet ve cihazların imalatı(hidrolik veya pnömatik otomatikayar veya kontrol aletleri ilemilometreler, pedometreler,stroboskoplar, monostatlar,kumpaslar, spektrometrelerdahil) Tehlikeli
26.52 Kol saatlerinin, masa ve duvarsaatlerinin ve benzerlerininimalatı
26.52.03 Devam kayıt cihazları, zamankayıt cihazları, parkmetreler;duvar ve kol saati makineli zamanayarlı anahtarların imalatı(vardiya saati vb.) Tehlikeli
26.52.04 Kol, masa, duvar ve cepsaatlerinin, bunlarınmakinelerinin, kasalarının ve diğerparçalarının imalatı (kronometrelerve taşıtlar için göstergepanellerinde bulunan saatler vebenzeri tipteki saatler dahil) Tehlikeli
26.6 Işınlama, elektro medikal veelektro terapi ile ilgilicihazların imalatı
26.60 Işınlama, elektro medikal veelektro terapi ile ilgilicihazların imalatı
26.60.01 Işınlama, elektromedikal veelektroterapi ile ilgili cihazlarınimalatı (elektro-kardiyografcihazı, işitme cihazı, radyolojicihazı, röntgen cihazları, X, Alfa,Beta, Gama, mor ötesi ve kızılötesi ışınların kullanımına dayalıcihazlar, vb.) Çok Tehlikeli
26.7 Optik aletlerin ve fotografikekipmanların imalatı
26.70 Optik aletlerin ve fotografikekipmanların imalatı
26.70.11 Objektif merceği, levha vetabaka halinde polarizan madde,renk filtresi, optik mercek,prizma, ayna ve diğer optikelemanlar ile dürbün, optikmikroskop, optik teleskop ve diğerastronomik aletler ile bunlarınaksam ve parçalarının imalatı Tehlikeli
26.70.12 Mikrofilm, mikrofiş ve diğermikroform okuyucuların imalatı Tehlikeli
26.70.13 Sinematografik kameraların veprojektörlerin, diyapozitif (slayt)ve diğer projektörlerinimalatı Tehlikeli
26.70.16 Fotoğraf makinesi imalatı(dijital, anında görüntü basan,dokümanların mikrofilm, vb. üzerinekaydedilmesinde, deniz altında,hava fotoğrafçılığında, adli tıpveya kriminolojik laboratuvarlarda,vb. kullanılanlar) Tehlikeli
26.70.19 Flaş lambaları, fotografikagrandisörler (büyütücüler),fotoğraf laboratuvarları içincihazlar, negatoskoplar (inceışıklı panel), projeksiyonekranları, likit kristal cihazlarile lazerlerin (lazer diyotlarhariç) imalatı Tehlikeli
26.8 Manyetik ve optik kaset, bant,CD, vb. ortamların imalatı
26.80 Manyetik ve optik kaset, bant,CD, vb. ortamların imalatı
26.80.01 Boş manyetik ses ve görüntükaset bantlarının imalatı (plakdahil) Tehlikeli
26.80.02 Manyetik şeritli kartlarınimalatı (boş telefon kartıdahil) Tehlikeli
26.80.03 Boş CD, DVD, disket, maviışınlı (blu-ray) disk, vb.ürünlerin imalatı (disk üretimiiçin kullanılan kalıp (matris) vemaster dahil) Tehlikeli
26.80.90 Bys. manyetik ve optikortamların imalatı Tehlikeli
27 Elektrikli teçhizatimalatı
27.1 Elektrik motoru, jeneratör,transformatör ile elektrik dağıtımve kontrol cihazlarınınimalatı
27.11 Elektrik motorlarının,jeneratörlerin vetransformatörlerin imalatı
27.11.01 Elektrik motoru, jeneratör vetransformatörlerin imalatı (aksamve parçaları hariç) Tehlikeli
27.11.03 Elektrik motoru, jeneratör vetransformatörlerin aksam veparçalarının imalatı Tehlikeli
27.12 Elektrik dağıtım ve kontrolcihazları imalatı
27.12.01 Elektrik devrelerininanahtarlanması, korunması ileelektriğin kontrol ve dağıtımınaözgü cihazların imalatı (sigorta,otomatik devre kesici, röle,yalıtım, devre ve yük ayırıcıanahtarlar, voltaj sınırlayıcı,dalga bastırıcı vb.) Tehlikeli
27.12.02 Elektrik devrelerininanahtarlanması, korunması veelektriğin kontrol ve dağıtımınaözgü cihazların parçalarınınimalatı (kumanda panosu için tablo,konsol, kabin vb. diğer mesnetlerdahil, elektrik düğmesi, fişi veprizi hariç) Tehlikeli
27.2 Akümülatör ve pil imalatı
27.20 Akümülatör ve pil imalatı
27.20.01 Elektrik akümülatörparçalarının imalatı (akümülatörplakaları, separatörler, kurşunızgaralar, akümülatör kutu vekapakları) Çok Tehlikeli
27.20.02 Şarj edilemeyen (birincil) pilve bataryalar ile bunların aksam veparçalarının imalatı (manganezdioksitli, cıva oksitli, gümüşoksitli, lityum oksitli, çinko-havareaksiyonlu pil ve bataryalar) Çok Tehlikeli
27.20.03 Akümülatör imalatı (kurşunasitli, nikel kadmiyum, nikel metalhidrit, lityum-iyon, lityumpolimer, nikel demir ve diğerelektrik akümülatörleri) Çok Tehlikeli
27.20.04 Şarj edilebilir pil ve bataryaile bunların parçalarınınimalatı Çok Tehlikeli
27.3 Kablolamada kullanılan tellerve kablolar ile gereçlerinimalatı
27.31 Fiber optik kablolarınimalatı
27.31.04 Fiber optik kablolarınimalatı Tehlikeli
27.32 Diğer elektronik ve elektriktelleri ve kablolarınınimalatı
27.32.03 Diğer elektronik ve elektriktelleri ve kablolarının imalatı(koaksiyel kablo ve diğer koaksiyelelektrik iletkenleri, yalıtılmışbobin telleri, izolasyonlu topraksu altı iletkenler, asetatlı vesilikonlu bakır iletkenler, vb.)(fiberoptik kablo hariç) Tehlikeli
27.33 Kablolamada kullanılangereçlerin imalatı
27.33.02 Kablolamada kullanılangereçlerin imalatı (fiş, soket,baskılı, düğmeli vb. anahtar, priz,duy, plastikten elektrik boru vekablo tablaları, makine vecihazları izole edici plastikbağlantı parçaları, vb.)(elektronik bileşenlerdekullanılanlar hariç) Tehlikeli
27.4 Elektrikli aydınlatmaekipmanlarının imalatı
27.40 Elektrikli aydınlatmaekipmanlarının imalatı
27.40.01 Deşarj ampulü, mor ötesi veyakızıl ötesi ampul, ark ampulü,tungsten halojen filamentli ampul,diğer filamentli ampul ilefotoğrafçılıkta kullanılan flaşampulü, flaş küpü ve benzerlerininimalatı Tehlikeli
27.40.02 Hava ve motorlu kara taşıtlarıiçin monoblok far üniteleri, kara,hava ve deniz taşıtları içinelektrikli aydınlatma donanımlarıveya görsel sinyalizasyonekipmanları imalatı (polisaraçları, ambulans vb. araçlarındış ikaz lambaları dahil) Tehlikeli
27.40.03 Avize, aplik ve diğerelektrikli aydınlatma armatürleri,sahne, fotoğraf veya sinemastüdyoları için projektörler vespot ışıkları, elektrikli masalambaları, çalışma lambaları,abajur vb. lambaların imalatı(süsleme için ışıklandırma setleridahil) Tehlikeli
27.40.04 Sokak aydınlatma donanımlarınınimalatı (trafik ışıklarıhariç) Tehlikeli
27.40.05 Pil, akümülatör veya manyetoile çalışan portatif elektriklambaları ve elektriksiz lambalarile el feneri, gaz ve lüks lambasıvb. aydınlatma armatürlerininimalatı (taşıtlar için olanlarhariç) Tehlikeli
27.40.06 Işıklı tabela, ışıklı reklampanosu ve benzerlerininimalatı Tehlikeli
27.40.07 Bys diğer lamba ve aydınlatmaarmatürleri ile lambaların,aydınlatma armatürü vebenzerlerinin aksam ve parçalarınınimalatı (cam veya plastiktenolanlar hariç) Tehlikeli
27.5 Ev aletleri imalatı
27.51 Elektrikli ev aletlerininimalatı
27.51.02 Ev tipi elektrikli suısıtıcıları (depolu su ısıtıcıları,anında su ısıtıcıları, şofben,termosifon dahil), elektrikliısıtma cihazları (elektrikli soba,radyatör, vb.) ve elektrikli toprakısıtma cihazlarının imalatı Tehlikeli
27.51.03 Ev tipi elektrikli süpürge vehalı temizleme/yıkama makineleriile kuru veya ıslak elektriklisüpürgeler, şarjlı veya pilli elsüpürgelerinin imalatı Tehlikeli
27.51.04 Mutfakta kullanılan elektrikliküçük ev aletlerinin imalatı (çayveya kahve makinesi, semaver,ızgara, kızartma cihazı, ekmekkızartma makinesi, mutfak robotu,mikser, blender, meyve sıkacağı, etkıyma makinesi, tost makinesi,fritöz vb.) Tehlikeli
27.51.05 Elektrikli diğer küçük evaletleri (elektrotermik el kurutmamakinesi, elektrikli ütü, havludispenseri, hava nemlendirici) ileelektrikli battaniyelerinimalatı Tehlikeli
27.51.06 Elektrikli kişisel bakımeşyalarının imalatı (elektriklitıraş makinesi, epilatör ve saçkesme makinesi, elektrotermik saçşekillendirme makinesi (saç kurutmamakinesi, bigudi, tarak, saçmaşası), elektrikli diş fırçası,vb.) Tehlikeli
27.51.07 Elektrikli ev aletleri aksam veparçalarının imalatı Tehlikeli
27.51.08 Ev tipi buzdolabı, dondurucu,çamaşır makinesi, çamaşır kurutmamakinesi, bulaşık makinesi,vantilatör, aspiratör, fan,aspiratörlü davlumbaz, fırın, ocak,mikrodalga fırın, elektriklipişirme sacı vb. imalatı Tehlikeli
27.51.90 Bys. diğer elektrikli evaletlerinin imalatı Tehlikeli
27.52 Elektriksiz ev aletlerininimalatı
27.52.02 Elektriksiz ev tipi gaz, sıvıveya katı yakıtlı soba, kuzine,ızgara, şömine, mangal, semaver, suısıtıcısı (termosifon, şofben vb.)vb. aletlerin imalatı Tehlikeli
27.52.05 Elektriksiz yemek pişirmecihazlarının imalatı (gaz yakıtlıset üstü ocaklar, gaz veya sıvıyakıtlı fırınlar ve ocaklarvb.) Tehlikeli
27.52.06 Elektriksiz ev aletlerininaksam ve parçalarının imalatı Tehlikeli
27.9 Diğer elektrikli ekipmanlarınimalatı
27.90 Diğer elektrikli ekipmanlarınimalatı
27.90.02 Elektrik kondansatörleri,dirençleri (ısıtma rezistanslarıhariç), reostaları vepotansiyometrelerin imalatı Tehlikeli
27.90.03 Elektrikli sinyalizasyon,güvenlik veya trafik kontrolekipmanlarının imalatı (demiryolları, kara yolları, iç suyolları, taşıt park alanları,limanlar ve hava meydanları için)(trafik ışıkları ve sinyaldonanımları dahil) Tehlikeli
27.90.04 Karbon elektrotlar ve elektrikişlerinde kullanılan grafitten veyakarbondan diğer ürünlerin imalatı(ısıtıcı kömür rezistanslar, pilkömürleri, ark lambaları ve diğerlambalar için kömürler vb.dahil) Çok Tehlikeli
27.90.05 Elektrikli kaynak ve lehimteçhizatı (lehim havyaları, arkkaynak makineleri, endüksiyonkaynak makineleri vb.) ilemetallerin veya sinterlenmiş metalkarbürlerin sıcak spreylenmesi içinelektrikli makine ve cihazlarınınimalatı Tehlikeli
27.90.06 Sıvı kristal cihazlı (LCD) veyaışık yayan diyotlu (LED) göstergepanelleri ile bys. elektrikli sesliveya görsel sinyalizasyoncihazlarının imalatı (elektroniksayı levhası (skorbord) dahil) Tehlikeli
27.90.08 Kendine özel fonksiyonu olanelektrikli makine ve cihazlarınimalatı (anten yükselteçleri,çitlere elektrik verici cihazlar,tercüme veya sözlük fonksiyonluelektrikli makineler, ses kayıtcihazlarında kullanılan gürültüazaltma üniteleri vb.) Tehlikeli
27.90.09 Elektrik yalıtkanlarının(izolatörlerinin) imalatı (cam veseramikten olanlar hariç) Tehlikeli
27.90.10 Solaryum yatakları, solaryumlambaları vb. bronzlaşmaekipmanlarının imalatı Tehlikeli
27.90.90 Bys. elektrikli diğerekipmanların imalatı(elektromıknatıslar,elektromanyetik kaplinler, frenlerve vinç başları ile elektrikliparçacık hızlandırıcılar, sinyaljeneratörleri vb.) Tehlikeli
28 Başka yerde sınıflandırılmamışmakine ve ekipman imalatı
28.1 Genel amaçlı makinelerinimalatı
28.11 Motor ve türbin imalatı (havataşıtı, motorlu taşıt ve motosikletmotorları hariç)
28.11.08 Türbin ve türbin parçalarınınimalatı (rüzgar, gaz, su ve buhartürbinleri ile su çarkları vebunların parçaları) (hava taşıtlarıiçin turbo jetler veya turbopervaneler hariç) Tehlikeli
28.11.09 Deniz taşıtlarında, demir yolutaşıtlarında ve sanayide kullanılankıvılcım ateşlemeli veya sıkıştırmaateşlemeli içten yanmalı motorlarınve bunların parçalarının imalatı(hava taşıtı, motorlu kara taşıtıve motosiklet motorları hariç) Tehlikeli
28.11.10 Tüm içten yanmalı motorlar,dizel motorlar vb.de kullanılanpistonlar, silindirler ve silindirblokları, silindir başları,silindir gömlekleri, emme ve egzossubapları, segmanlar, hareketkolları, karbüratörler, yakıtmemeleri vb.nin imalatı Tehlikeli
28.12 Akışkan gücü ile çalışanekipmanların imalatı
28.12.05 Akışkan gücü ile çalışanekipmanların ve bunlarınparçalarının imalatı (hidrolik vepnömatik motorlar, hidrolikpompalar, hidrolik ve pnömatikvalfler, hidrolik sistemler vebunların parçaları) Tehlikeli
28.13 Diğer pompaların vekompresörlerin imalatı
28.13.01 Hava veya vakum pompaları ilehava veya diğer gazkompresörlerinin imalatı (el veayakla çalışan hava pompaları ilemotorlu taşıtlar için olanlarhariç) Tehlikeli
28.13.02 Sıvı pompaları ve sıvıelevatörleri imalatı (yakıt,yağlama, soğutma ve diğer amaçlariçin) (deplasmanlı ve santrifüjlüpompalar ile benzinliklerdekullanılan akaryakıt pompalarıdahil) (tulumba dahil, içtenyanmalı motorlar için olanlarhariç) Tehlikeli
28.13.03 El ve ayakla çalışan havapompalarının imalatı Tehlikeli
28.13.04 İçten yanmalı motorlara monteedilmek üzere tasarlanmışpompaların imalatı (yağ pompaları,yakıt pompaları (benzin, mazot vb.pompaları) ve soğutmapompaları) Tehlikeli
28.14 Diğer musluk ve valf/vanaimalatı
28.14.01 Diğer musluk ve valf/vanaimalatı, dökme olanlar (sanayimusluk, valf ve vanaları, sıhhitesisat ve ısıtmada kullanılanmusluk ve vanalar ile doğalgazvanaları dahil) Çok Tehlikeli
28.14.02 Diğer musluk ve valf/vanaimalatı (sanayi musluk, valf vevanaları, sıhhi tesisat ve ısıtmadakullanılan musluk ve vanalar iledoğalgaz vanaları dahil, dökmeolanlar hariç) Tehlikeli
28.15 Rulman, dişli/dişli takımı,şanzıman ve tahrik elemanlarınınimalatı
28.15.01 Rulmanlar ve mekanik güçaktarma donanımları imalatı(bilyeli ve makaralı rulmanlar,aktarma milleri (şaftları), kam vekrank milleri, kranklar vb. ilerulman yatakları, düz milrulmanları, yatak kovanları ve milşaft yatakları vb.) Tehlikeli
28.15.02 Debriyajlar (kavramalar), mil(şaft) kaplinler ve üniversalmafsalların imalatı (motorlu karataşıtlarında kullanılan debriyajlarhariç) Tehlikeli
28.15.03 Dişliler/dişli takımları,bilyeli ve makaralı vidalar,şanzımanlar, vites kutuları vediğer hız değiştiricilerin imalatı(motorlu kara taşıtlarındakullanılan vites kutuları vediferansiyelleri hariç) Tehlikeli
28.15.04 Volanlar ve kasnaklar ilemafsallı bağlantı zincirleri ve güçaktarım zincirlerinin imalatı Tehlikeli
28.2 Genel amaçlı diğer makinelerinimalatı
28.21 Fırın, ocak (sanayi ocakları)ve brülör (ocak ateşleyicileri)imalatı
28.21.07 Elektrikli veya elektriksizlaboratuar ocakları, döküm ocaklarıvb. endüstriyel ocak vefırınlarının imalatı (çöp yakmafırınları ile elektrikli ekmek veunlu mamul fırınları dahil) Tehlikeli
28.21.08 Ocak brülörleri(ateşleyicileri) imalatı Tehlikeli
28.21.09 Mekanik kömür taşıyıcıları,mekanik ızgaralar, mekanik külboşaltıcıları ve benzeri cihazlarınimalatı Tehlikeli
28.21.10 Güneşle (güneş kolektörleri),buharla ve yağla ısıtma sistemleriile benzeri ocak ve ısınmadonanımları gibi elektriksiz evtipi ısıtma donanımlarınınimalatı Tehlikeli
28.21.11 Endüksiyon veya dielektrikısıtma ekipmanlarının imalatı Tehlikeli
28.21.90 Başka yerde sınıflandırılmamışdiğer fırın ve ocakların (sanayiocakları) imalatı Tehlikeli
28.22 Kaldırma ve taşıma ekipmanlarıimalatı
28.22.10 El veya motor gücü ile çalışankaldırma, taşıma, yükleme ya daboşaltma makinelerinin imalatı(vinç palangası, yük asansörü,bocurgat, demir ırgat, kriko,forklift, kaldırma ve taşımakuleleri, vinçler, hareketlikaldırma kafesleri vb.) Tehlikeli
28.22.11 Asansör, yürüyen merdiven veyürüyen yolların imalatı(yeraltında kullanılanlarhariç) Tehlikeli
28.22.12 Pnömatik ve diğer devamlıhareketli asansör, elavatör vekonveyörlerin imalatı Tehlikeli
28.22.13 Diğer kaldırma, taşıma, yüklemeveya boşaltma makinelerinin imalatı(teleferikler, telesiyejler vb.için çekme mekanizmaları, tarımsalkullanım için yükleme makineleri vediğerleri) Tehlikeli
28.23 Büro makineleri ve ekipmanlarıimalatı (bilgisayarlar ve çevrebirimleri hariç)
28.23.01 Hesap makineleri ve hesaplamafonksiyonu olup verilen bilgilerikaydeden, kaydedilen bilgileriyeniden veren ve gösteren cep tipimakinelerin imalatı (elektrikli,elektronik, mekanik vb.) Tehlikeli
28.23.02 Dikte makinelerinin imalatı(taşınabilir ve küçük ses kayıtcihazları) Tehlikeli
28.23.03 Yazarkasa imalatı Tehlikeli
28.23.04 Para sayma ve para paketlememakinelerinin imalatı Tehlikeli
28.23.05 Daktilo, stenografi ve kelimeişlem makineleri imalatı(elektrikli veya elektriksiz)(kabartma yazı yazanlar dahil) Tehlikeli
28.23.06 Fotokopi ve termokopimakineleri ile büro tipi ofsetbaskı makinelerinin (kağıt ebadı<=22×36 cm) imalatı Tehlikeli
28.23.07 Toner kartuşu, delgi aleti,zımba makinesi, bant kesicisi, yazıtahtası (akıllı tahta dahil),kalemtıraş vb. büro alet vedonanımlarının imalatı Tehlikeli
28.23.08 Teksir makineleri, posta işlememakineleri, adres basma makineleriile diğer büro makinelerininimalatı Tehlikeli
28.24 Motorlu veya pnömatik (havabasınçlı) el aletlerininimalatı
28.24.01 Motorlu veya pnömatik elaletlerinin imalatı (zımparalama,taşlama, parlatma vb. elektriklielle kullanılan aletler iledairesel veya zincirli testere,matkap, çivileme aleti, perçintabancası vb.) Tehlikeli
28.25 Soğutma ve havalandırmadonanımlarının imalatı, evdekullanılanlar hariç
28.25.01 Sanayi tipi soğutucu vedondurucu donanımları ile ısıpompalarının imalatı (camekanlı,tezgahlı veya mobilya tipisoğutucular, kondenserleri ısıdeğiştiricisi fonksiyonu görenkompresörlü üniteler vb.) Tehlikeli
28.25.02 Sanayi tipi fan vevantilatörlerin imalatı (çatıhavalandırma pervaneleridahil) Tehlikeli
28.25.03 İklimlendirme cihazlarının(klimalar) imalatı (motorlutaşıtlarda kullanılanlardahil) Tehlikeli
28.25.04 Isı değiştirici birimlerin(eşanjörler), hava veya diğergazların sıvılaştırılmasındakullanılan makinelerin vehava/gazların filtrelenmesi vearıtılması için kullanılan makineve cihazların imalatı Tehlikeli
28.29 Başka yerde sınıflandırılmamışdiğer genel amaçlı makinelerinimalatı
28.29.01 Petrol rafinerileri, kimyasanayi, içecek sanayi vb. içindamıtma ve rektifiye donanımlarıimalatı Tehlikeli
28.29.02 Gaz jeneratörleri, su gazıjeneratörleri, asetilen gazıjeneratörleri ve benzerlerininimalatı Tehlikeli
28.29.03 Şişeleri veya diğer muhafazakaplarını temizleme ve kurutmamakineleri imalatı (kavanoz, bidon,fıçı, kutu vb.) Tehlikeli
28.29.04 Sıvılar için filtreleme veyaarıtma makine ve cihazlarınınimalatı (suyun filtreedilmesi/arıtılmasına mahsuscihazlar dahil) Tehlikeli
28.29.05 Doldurma, paketleme veambalajlama makinelerinin imalatı(doldurma, kapatma, mühürleme,kapsülleme veya etiketleme veiçecekleri gazlandırma vb. içinmakineler) Tehlikeli
28.29.06 Otomatik ürün satışmakinelerinin imalatı (yiyecek,içecek, vb. otomatik satışmakinesi) (para bozma makineleridahil) Tehlikeli
28.29.07 Metal tabakalardan contalarınve mekanik salmastraların imalatı(diğer malzemelerle birleştirilmişmetal tabakalardan veya iki ya dadaha fazla metal tabakasındanyapılmış olanlar) Tehlikeli
28.29.08 Tartı aletleri ve baskülimalatı (ev ve dükkanlardakullanılan terazi ve kantarlar,sürekli ölçüm için tartılar, taşıtbaskülleri (köprü tipi basküller)vb.) (kuyumculukta velaboratuvarlarda kullanılan hassastartılar hariç) Tehlikeli
28.29.09 Santrifüj imalatı (kremamakinesi, çamaşır kurutma makinesi,laboratuvarlarda kullanılanlarhariç) Tehlikeli
28.29.10 Yangın söndürücüler, püskürtmetabancaları, buhar veya kumpüskürtme makineleri vb. sıvı vetozları atan, dağıtan ya dapüskürten mekanik cihazlarınimalatı Tehlikeli
28.29.11 Elektrikli olmayan kaynak velehim aletleri ile gazla çalışanyüzey temperleme (menevişleme)makine ve cihazlarının imalatı(pürmüz ve şalümolar dahil) Tehlikeli
28.29.12 Sanayi tipi bulaşıkmakinelerinin imalatı Tehlikeli
28.29.17 Kalender veya diğer haddemakinelerinin imalatı (metal ve camiçin olanlar hariç) Tehlikeli
28.29.18 İçten yanmalı motorlar için yağfiltresi, yakıt filtresi, havafiltresi, gres nipelleri, yağkeçesi ve benzerlerininimalatı Tehlikeli
28.29.19 Seviye tespit aletleri(nivolar), ölçü çubukları, mezura,çelik metre ve cetveller ile ellekullanılan diğer ölçü aletlerininimalatı Tehlikeli
28.29.20 Maddelerin ısı değişimi yoluylaişlenmesi için bys. makinelerinimalatı (su sirkülasyonu yoluyladoğrudan soğutma için soğutmakuleleri ve benzerleri ilemetallerin buhar biriktirme yoluylakaplanması için vakum-buhartesisleri vb.) Tehlikeli
28.3 Tarım ve ormancılıkmakinelerinin imalatı
28.30 Tarım ve ormancılıkmakinelerinin imalatı
28.30.08 Tarımsal amaçlı römork veyayarı-römork imalatı Tehlikeli
28.30.09 Yumurta, meyve ve diğertarımsal ürünlerin temizlenmesi,tasnif edilmesi veyaderecelendirilmesi için kullanılanmakine ve ekipmanların imalatı Tehlikeli
28.30.10 Traktörlerin ve yaya kontrollütraktörlerin (motokültörler)imalatı Tehlikeli
28.30.11 Kümes hayvanı makineleri,arıcılık makineleri ve hayvan yemihazırlama makinelerinin vedonanımlarının imalatı (kuluçkamakineleri dahil) Tehlikeli
28.30.12 Çim biçme makinelerinin imalatı(traktörlere monte edilen kesicibarlar dahil) Tehlikeli
28.30.13 Hasat ve harman makinelerininimalatı (biçer-döver, saman yapmamakinesi, ot ve saman balyalamamakinesi, kök ve yumru hasatmakinesi, vb.) Tehlikeli
28.30.14 Pulluk, saban, tırmık, diskaro,skarifikatör, kültivatör, çapamakinesi, mibzer, fide ve fidandikim makinesi vb. toprağınhazırlanmasında, ekiminde,dikiminde kullanılan aletler ilegübreleme makinelerininimalatı Tehlikeli
28.30.15 Süt sağma makinelerininimalatı Tehlikeli
28.30.16 Tarım ve bahçeciliktekullanılan sıvı veya toz atma,dağıtma veya püskürtmemakinelerinin imalatı (sulamacihazları, pülverizatörler, ziraimücadelede kullanılan portatif sıvıve toz püskürtücüler vb.) Tehlikeli
28.30.17 Ormancılığa özgü makineler iletarla bahçe bakımına mahsus diğermakine ve cihazların imalatı Tehlikeli
28.4 Metal işleme makineleri vetakım tezgahları imalatı
28.41 Metal işleme makinelerininimalatı
28.41.01 Takım tezgahları (metal işlemekiçin lazer ve benzerleriyleçalışanlar) ile metal vebenzerlerini işlemek için işlememerkezlerinin imalatı Tehlikeli
28.41.03 Metal tornalama, delme,frezeleme ve planyalama takımtezgahlarının imalatı Tehlikeli
28.41.06 Metal işlemek için kullanılandiğer takım tezgahlarınınimalatı Tehlikeli
28.41.07 Metal işleyen takımtezgahlarının parça veaksesuarlarının imalatı (alettutacakları ve kendinden açılanpafta kafaları, iş tutacakları,ayırıcı kafalar ve takım tezgahlarıiçin diğer özel aksesuarlarhariç) Tehlikeli
28.49 Diğer takım tezgahlarınınimalatı
28.49.02 Elektro kaplama makinelerininimalatı (galvanoplasti, elektrokaplama, elektroliz veyaelektroforez için) Tehlikeli
28.49.03 Taş, seramik, beton veyabenzeri mineral malzemeleri işlemekveya camı soğuk işlemek için olantakım tezgahı ile bunlarınparçalarının imalatı (testere,taşlama, parlatma, vb.) Tehlikeli
28.49.04 Ahşap, mantar, kemik, sertkauçuk, sert plastik veya benzerisert malzemeleri işlemek için olantakım tezgahı ile bunlarınparçalarının imalatı (transfer,testere, planya, freze, taşlama,zımparalama, parlatma, bükme,delme, dilimleme, pres, vb.) Tehlikeli
28.49.05 Takım tezgahları ve el aletleriiçin takım tutucuları ve kendindenaçılan pafta kafaları, işlenecekparça tutucuları, bölme başlıklarıve diğer özel ek parçalar,dingiller, yüksükler ve rakorlarile fikstürlerin imalatı Tehlikeli
28.49.90 Başka yerde sınıflandırılmamışdiğer takım tezgahlarınınimalatı Tehlikeli
28.9 Diğer özel amaçlı makinelerinimalatı
28.91 Metalürji makineleriimalatı
28.91.01 Konvertörler (metalürji), külçekalıpları (ingot kalıpları), dökümkepçeleri, döküm makineleri, vb.sıcak metallerin işlenmesi içinkullanılan makine ve teçhizatınimalatı Tehlikeli
28.91.02 Sıcak ve soğuk metal haddelememakinesi ve metal boru imaline özgühadde makinesi ile hadde vemetalürji makineleri için silindirve diğer parçaların imalatı Tehlikeli
28.92 Maden, taş ocağı ve inşaatmakineleri imalatı
28.92.01 Beton ve harç karıştırıcılarınimalatı (mikserler dahil, betonkarıştırıcılı (mikserli) kamyonlarhariç) Tehlikeli
28.92.02 Buldozer, angledozer, greyder,skreyper, düzleyici, öndenküreyici-yükleyici, kepçeliyükleyici, mekanik kepçe,ekskavatör, kazık çakma (kazıkvaryosları) ve sökme makineleri,harç ve asfalt yayıcılar ile betonkaplama makinelerinin imalatı Tehlikeli
28.92.03 Taş, toprak, cevher, alçı,çimento ve diğer mineral maddeleritasnif etme, eleme, ayırma, yıkama,ezme, öğütme, karıştırma, yoğurmavb. işlemden geçirme içinkullanılan makinelerin imalatı(beton ve harç karıştırıcılar(mikserler) hariç) Tehlikeli
28.92.05 Kömür veya kaya kesicileri(havözler), tünel ve kuyu açmamakineleri ile delme ve sondajmakinelerinin imalatı (yeraltı veyayerüstü) Tehlikeli
28.92.06 Yer altı kullanımı için süreklihareketli elevatör ve konveyörlerinimalatı Tehlikeli
28.92.08 Paletli traktörlerin imalatı(inşaat veya madenciliktekullanılan traktörler) Tehlikeli
28.92.09 Kara yolu dışında kullanılandamperli kamyonların imalatı (megakamyonlar) Tehlikeli
28.92.10 Kar küreyici ve püskürtücüleri,toprağı sıkıştırmaya veya bastırıpsıkıştırmaya mahsus makineler ilemaden, taşocağı, inşaat, imar, parkvb. işler için kullanılan diğermakinelerin imalatı Tehlikeli
28.92.11 Delme, sondaj, hafriyat ve kazımakinesi parçalarının, vinç vehareketli kaldırma kafeslerinin vetoprak, taş ve benzeri maddeleritasnifleme, öğütme, karıştırma veyadiğer işlerde kullanılan makineparçalarının imalatı (buldozerbıçakları dahil) Tehlikeli
28.93 Gıda, içecek ve tütün işlememakineleri imalatı
28.93.01 Gıda ve içeceklerin endüstriyelolarak hazırlanması veya imalatıiçin bys. makinelerin imalatı(ekmek, bisküvi, makarna,şekerleme, çikolata, şeker, et,meyve, sebze, sıvı ve katı yağlarvb.nin hazırlanması veya imalatıiçin sanayi makineleri) Tehlikeli
28.93.02 Şarap, meyve suyu ve benzeriiçeceklerin imalatında kullanılanmakinelerin imalatı (presler,eziciler ve benzeri makineler) Tehlikeli
28.93.03 Süt ürünleri makinelerinin vesantrifüjlü krema ayırıcılarınınimalatı (homojenizeleştiriciler,irradyatörler (ışınlayıcılar), yağyapma makineleri, peynir yapmamakineleri vb.) Tehlikeli
28.93.04 Tütünün hazırlanmasında veişlenmesinde kullanılan makinelerinimalatı (tütün yapraklarınıdamarlarından ayıran makineler ileenfiye, sigara, puro, pipo tütünüveya çiğneme tütünleri imalindekullanılan makineler) Tehlikeli
28.93.06 Değirmencilik sanayiinde,hububat veya kurutulmuş sebzelerinişlenmesi veya öğütülmesi içinkullanılan makinelerin imalatı (un,kaba un vb. üretmek için kullanılanmakineler, elekler, kepektemizleyiciler, çeltik soymamakinesi vb.) Tehlikeli
28.93.07 Ekmek ve diğer unlu mamulleriçin elektrikli olmayan fırınlarınimalatı (gaz, sıvı ve katı yakıtlıolanlar) Tehlikeli
28.93.08 Ev tipi olmayan pişirme veyaısıtma cihazlarının imalatı (evtipi olmayan filtreli kahvemakineleri vb. dahil) Tehlikeli
28.93.09 Tarımsal ürünler içinkurutucuların imalatı (kahve,kuruyemiş vb. için kavurma makineve cihazları dahil) Tehlikeli
28.93.10 Tohumların, tanelerin veya kurubaklagillerin temizlenmesi, tasnifedilmesi veya derecelendirilmesiiçin kullanılan makinelerin imalatı(tarımsal selektörler dahil) Tehlikeli
28.94 Tekstil, giyim eşyası ve deriüretiminde kullanılan makinelerinimalatı
28.94.01 Post, deri ve köselelerinişlenmesi ile ayakkabı ve diğerderi eşyaların üretimi veya tamiriiçin kullanılan makinelerinimalatı Tehlikeli
28.94.02 Sanayi tipi çamaşır makinesi,kuru temizleme makinesi, çamaşırkurutma makinesi, ütü makinesi vepres ütü imalatı Tehlikeli
28.94.03 Sanayi ve ev tipi dikişmakinelerinin imalatı (dikişmakinelerinin iğneleri,mobilyaları, tabanları, kapaklarıvb. parçaları dahil) Tehlikeli
28.94.04 Suni ve sentetik tekstilmalzemesinin ekstrüzyonu,çekilmesi, tekstüre edilmesi veyakesilmesi için kullanılan makinelerile doğal tekstil elyafı hazırlamamakineleri ve dokuma makinelerininimalatı (çırçır makinesi, taraklamamakinesi vb. dahil) Tehlikeli
28.94.05 Tekstil ipliği ve kumaşınıyıkama, ağartma, boyama, apreleme,temizleme, sıkma, sarma, emprenyeetme, bitirme, kesme, surfile vebenzerleri için makineler ile keçeimalatında ve bitirilmesindekullanılan makinelerin imalatı Tehlikeli
28.94.06 Tekstil büküm makineleri ilekatlama, bükme, bobine sarma veyaçile yapma makinelerininimalatı Tehlikeli
28.94.07 Örgü, trikotaj ve benzerimakineler ile tafting makinelerininimalatı (gipe iplik, tül, dantel,nakış, süs, örgü veya ağ yapmamakineleri dahil) Tehlikeli
28.94.08 Tekstil amaçlı makinelerlekullanılan yardımcı makinelerin vetekstil baskı makinelerinin imalatı(ratiyerler, jakardlar, vb.) (ofsetbaskı makineleri, tipografik,fleksografik, gravür baskımakineleri hariç) Tehlikeli
28.94.09 Tekstil, giyim eşyası ve deriüretiminde kullanılan makinelerinparçalarının imalatı (dikişmakinelerinde kullanılanlarhariç) Tehlikeli
28.95 Kağıt ve mukavva üretimindekullanılan makinelerin imalatı
28.95.01 Kağıt ve mukavva üretimindekullanılan makinelerin ve bunlarınparçalarının imalatı Tehlikeli
28.96 Plastik ve kauçuk makinelerininimalatı
28.96.01 Plastik ve kauçuk makinelerininimalatı (plastik ve kauçuk işlemekiçin veya bu malzemelerden ürünimalatı için kullanılanmakineler) Tehlikeli
28.99 Başka yerde sınıflandırılmamışdiğer özel amaçlı makinelerinimalatı
28.99.01 Basım ve ciltleme makineleriile basıma yardımcı makinelerin vebunların parçalarının imalatı(ofset baskı makinesi, tipografikbaskı makinesi, dizgi makinesi,baskı kalıpları için makineler,ciltleme makinesi vb.) (büro tipibaskı makinesi hariç) Tehlikeli
28.99.02 Cam ve cam eşya imalatında vecam eşyaların sıcak işlenmesindekullanılan makinelerin veelektrikli veya elektronik lamba,tüp, ampul montajında kullanılanmakinelerin imalatı Tehlikeli
28.99.04 Kiremit, briket, şekilliseramik hamuru, boru, grafitelektrotu, yazı tahtası tebeşirivb. ürünlerin üretilmesindekullanılan makinelerin imalatı Tehlikeli
28.99.05 Otomatik bovling salonudonanımlarının, dönme dolap, atlıkarınca, salıncak, poligon, vb.diğer panayır alanı eğlencedonanımları ile kumarhane oyunmasalarının imalatı Tehlikeli
28.99.06 Hava taşıtı fırlatmadonanımlarının, uçak gemilerindekullanılan katapultların (kısamesafede hava taşıtlarınınkalkmasını sağlayan mekanizma) veilgili donanımların imalatı Tehlikeli
28.99.07 Yarı iletken tek kristallikülçe (boules) ve yonga plakalarile yarı iletken aygıtların,elektronik entegre devre veya düzpanel ekranların imalatı içinkullanılan makine ve cihazlarınimalatı Tehlikeli
28.99.08 Sicim ve halat makinelerininimalatı Tehlikeli
28.99.09 Lastik tekerlerin balansında vehizalanmasında kullanılandonanımların imalatı (jant içinkullanılanlar hariç) Tehlikeli
28.99.10 Özel amaçlar için çoklugörevlerde kullanılabilen sanayirobotlarının imalatı Tehlikeli
28.99.11 Kurutucuların imalatı (odun,kağıt hamuru, kağıt, mukavva, süttozu ve diğer malzemelerinimalatında kullanılanlar) (ev tipi,tarım ürünleri ve tekstil içinolanlar hariç) Tehlikeli
28.99.12 İzotopik ayırma makineleri vecihazlarının imalatı Çok Tehlikeli
28.99.90 Başka yerde sınıflandırılmamışdiğer özel amaçlı makinelerinimalatı Tehlikeli
29 Motorlu kara taşıtı, treyler(römork) ve yarı treyler (yarırömork) imalatı
29.1 Motorlu kara taşıtlarınınimalatı
29.10 Motorlu kara taşıtlarınınimalatı
29.10.01 Kamyonet, kamyon, yarırömorklar için çekiciler,tankerler, vb. karayolutaşıtlarının imalatı Tehlikeli
29.10.02 Otomobil ve benzeri araçlarınimalatı Tehlikeli
29.10.03 Motorlu kara taşıtlarınınmotorlarının imalatı (motorlarınfabrikada yeniden yapımıdahil) Tehlikeli
29.10.04 Minibüs, midibüs, otobüs,troleybüs, metrobüs, vb. yolcunakil araçlarının imalatı Tehlikeli
29.10.05 Kar motosikleti, golf arabası,ATV motosikletler, go-kartarabaları vb. taşıtlarınimalatı Tehlikeli
29.10.07 Özel amaçlı motorlu karataşıtlarının imalatı (amfibiaraçlar, çöp kamyonu, yol temizlemearaçları, zırhlı nakil araçları,mikserli kamyon, vinçli kamyon,itfaiye aracı, ambulans, motorlukaravan vb.) Tehlikeli
29.10.08 Motorlu kara taşıtları içinşasi imalatı Tehlikeli
29.2 Motorlu kara taşıtları karoseri(kaporta) imalatı; treyler (römork)ve yarı treyler (yarı römork)imalatı
29.20 Motorlu kara taşıtları karoseri(kaporta) imalatı; treyler (römork)ve yarı treyler (yarı römork)imalatı
29.20.01 Treyler (römork), yarı treyler(yarı römork) ve mekanik hareketettirici tertibatı bulunmayan diğeraraçların parçalarının imalatı (buaraçların karoserleri, kasaları,aksları ve diğer parçaları) Tehlikeli
29.20.02 Motorlu kara taşıtları içinkaroser, kabin, kupa, dorse vedamper imalatı (otomobil, kamyon,kamyonet, otobüs, minibüs, traktör,damperli kamyon ve özel amaçlımotorlu kara taşıtlarınınkaroserleri) Tehlikeli
29.20.03 Konteyner imalatı (bir veyadaha fazla taşıma şekline göre özelolarak tasarlanmış olanlar) Tehlikeli
29.20.04 Treyler (römork) ve yarıtreyler (yarı römork) imalatı(karavan tipinde olanlar vetarımsal amaçlı olanlar hariç) Tehlikeli
29.20.05 Karavan tipinde treyler(römork) ve yarı treyler (yarırömork) imalatı – ev olarak veyakamp için Tehlikeli
29.20.06 Motorlu kara taşıtlarınınmodifiye edilmesi ve karoserhizmetleri Tehlikeli
29.3 Motorlu kara taşıtları içinparça ve aksesuar imalatı
29.31 Motorlu kara taşıtları içinelektrik ve elektronik donanımlarınimalatı
29.31.04 Motorlu taşıtlar için ateşlemekablo takımları ve diğer kablosetleri ile ateşleme bujisi vemanyetosu, dinamo, manyetik volan,distribütör, ateşleme bobini, marşmotoru, alternatör vb. imalatı Tehlikeli
29.31.05 Motorlu kara taşıtları vemotosikletler için elektriklisinyalizasyon donanımları,kornalar, sirenler, camsilecekleri, buğu önleyiciler,elektrikli cam/kapı sistemleri,voltaj regülatörleri vb. elektrikliekipmanların imalatı Tehlikeli
29.31.06 Oto alarm sistemlerininimalatı Tehlikeli
29.31.07 Bisikletler için elektrikliveya pille çalışan aydınlatma veyaişaret cihazlarının imalatı(bisiklet dinamoları dahil) Tehlikeli
29.32 Motorlu kara taşıtları içindiğer parça ve aksesuarlarınimalatı
29.32.20 Motorlu kara taşıtları içindiğer parça ve aksesuarlarınimalatı (fren, vites kutusu, jant,süspansiyon sistemleri, amortisör,radyatör, egzoz, debriyaj,direksiyon kutusu, rot, rotbaşı,rotil vb.) (traktör, itfaiyearaçları, vb. için olanlardahil) Tehlikeli
29.32.21 Motorlu kara taşıtları içinkaroser, kabin ve kupalara aitparça ve aksesuarların imalatı(tamponlar, koltuk emniyetkemerleri, hava yastıkları, kapılarvb. dahil) Tehlikeli
29.32.22 Motorlu kara taşıtları içinkoltuk imalatı (demiryolu vehavayolu için olanlar hariç) Tehlikeli
30 Diğer ulaşım araçlarınınimalatı
30.1 Gemi ve tekne yapımı
30.11 Gemilerin ve yüzen yapılarıninşası
30.11.01 Yüzen ve su altında kalabilensondaj platformlarının inşasıfaaliyetleri Çok Tehlikeli
30.11.02 Yolcu gemi ve tekneleri,feribotlar, tankerler, frigorifikgemiler, kuru yük gemileri, çekicive itici römorkörler, tarakgemileri, açık deniz gemileri,hover kraftların ve diğer gemilerininşası (spor ve eğlence amaçlıolanlar hariç) Çok Tehlikeli
30.11.03 Savaş gemileri vedenizaltıların imalatı Çok Tehlikeli
30.11.04 Balıkçı gemi ve tekneleri iledeniz ürünlerinin işlenmesine vesaklanmasına yönelik fabrikagemilerinin yapımı Çok Tehlikeli
30.11.05 Yüzen rıhtımlar, dubalar,batardolar, koferdamlar, yüzeniskeleler, şamandıralar, yüzentanklar, mavnalar, salapuryalar,yüzen vinçler, eğlence amaçlıolmayan şişme botlar vb.imalatı Çok Tehlikeli
30.11.06 Gemiler ve yüzer yapılar içinoturulacak yerlerin imalatı Çok Tehlikeli
30.11.07 Gemiler ve yüzer yapılar içiniç bölmelerin imalatı Çok Tehlikeli
30.11.08 Gemilerin, yüzer platformlarınve yüzer yapıların büyük çaptadeğiştirilmesi ve yenideninşası Çok Tehlikeli
30.12 Eğlence ve spor amaçlıteknelerin yapımı
30.12.01 Jet ski vb. kişisel suaraçlarının imalatı Tehlikeli
30.12.03 Şişirilebilir motorlu/motorsuzbotların imalatı (eğlence ve sporamaçlı olanlar) Tehlikeli
30.12.04 Eğlence ve sportif amaçlımotorlu/motorsuz yelkenlilerin,motorlu tekne ve yatların,sandalların, kayıkların, kanoların,eğlence amaçlı hover kraftların vebenzer araçların imalatı (polyestertekneler dahil) Çok Tehlikeli
30.2 Demir yolu lokomotifleri vevagonlarının imalatı
30.20 Demir yolu lokomotifleri vevagonlarının imalatı
30.20.01 Demir yolu ve tramvaylokomotifleri, vagonları, bagajvagonları, lokomotif tenderleri,demir yolu veya tramvay bakım veyaservis araçları imalatı(lokomotiflere ve vagonlara aitparçalar ile koltuklarının imalatıhariç) Tehlikeli
30.20.02 Demir yolu ve tramvay lokomotifveya vagonlarının parçalarınınimalatı Tehlikeli
30.20.03 Raylı sistem taşıtları içinkoltuk imalatı Tehlikeli
30.20.04 Mekanik veya elektromekaniksinyalizasyon, emniyet veya trafikkontrol cihazları ve bunlarınparçalarının imalatı (demir yolu,tramvay hatları, kara yolları,dahili su yolları, park yerleri,liman tesisleri veya hava alanlarıiçin olanlar) Tehlikeli
30.20.05 Demir yolu veya tramvaylokomotiflerinin ve vagonlarınınbüyük çapta yenilenmesi ve donanımhizmetleri (tamamlama) Tehlikeli
30.3 Hava taşıtları ve uzay araçlarıile bunlarla ilgili makinelerinimalatı
30.30 Hava taşıtları ve uzay araçlarıile bunlarla ilgili makinelerinimalatı
30.30.01 Helikopter imalatı (helikopterveya helikopter motorlarınınfabrikalarda büyük çaplı revizyonuve değiştirilmesi dahil) Tehlikeli
30.30.02 Hava taşıtı parçalarınınimalatı (uçak gövdesi, kanatları,kapıları, kumanda yüzeyleri, iniştakımları gibi ana montajparçaları, pervaneler, helikopterrotorları, motorlar, turbo jetler,turbo pervaneli motorlar vb. ilebunların parçaları) Tehlikeli
30.30.03 Sıcak hava balonu, zeplin,planör, delta kanatlı planör vediğer motorsuz hava araçlarınınimalatı Tehlikeli
30.30.04 Uçak ve benzer havataşıtlarının imalatı (uçak veyauçak motorlarının fabrikalardabüyük çaplı revizyonu vedeğiştirilmesi dahil) Tehlikeli
30.30.05 Yer uçuş eğitim cihazları vebunların parçalarının imalatı Tehlikeli
30.30.06 Uzay aracı, uzay aracı fırlatmaaraçları ve mekanizmaları ileuydular, uzay roketleri, yörüngeistasyonları ve uzay mekiklerininimalatı Çok Tehlikeli
30.30.07 Kıtalar arası balistikfüzelerin (ICBM) imalatı Çok Tehlikeli
30.30.08 Hava taşıtları ve uzayaraçlarında kullanılan koltuklarınimalatı Tehlikeli
30.4 Askeri savaş araçlarınınimalatı
30.40 Askeri savaş araçlarınınimalatı
30.40.01 Askeri savaş araçlarınınimalatı (tank, zırhlı savaşaraçları ve bunlarınparçaları) Çok Tehlikeli
30.9 Başka yerde sınıflandırılmamışulaşım araçlarının imalatı
30.91 Motosiklet imalatı
30.91.01 Motosiklet, moped ve motorlubisiklet (bir yardımcı motorubulunan bisikletler) imalatı Tehlikeli
30.91.02 Motosiklet parça veaksesuarları imalatı (sele,motosiklet yan sepeti, motosikletvitesi vb.) Tehlikeli
30.91.03 Motosiklet motorlarıimalatı Tehlikeli
30.92 Bisiklet ve engelli aracıimalatı
30.92.01 Motorsuz bisiklet imalatı (üçtekerlekli servis bisikleti, iki yada daha fazla kişilik bisiklet,yarış bisikleti, vitesli bisiklet)(çocuklar için plastik bisikletlerhariç) Tehlikeli
30.92.02 Bisiklet parça veaksesuarlarının imalatı (jantlar,gidonlar, iskelet, çatallar, pedalfren göbekleri/poyraları,göbek/poyra frenleri,krank-dişlileri, pedallar veserbest dişlilerin parçaları,vb.) Tehlikeli
30.92.03 Engelli araçlarının imalatı(motorlu, motorsuz, akülü, şarjlı,vb.) Tehlikeli
30.92.04 Engelli araçlarının parça veaksesuarlarının imalatı Tehlikeli
30.92.05 Bebek arabaları, pusetler vebunların parçalarının imalatı Tehlikeli
30.99 Başka yerde sınıflandırılmamışdiğer ulaşım ekipmanlarınınimalatı
30.99.01 Mekanik hareket ettiricitertibatı bulunmayan araçlarınimalatı (alışveriş arabaları,sanayi el arabaları, işportacıarabaları, bagaj arabaları, elleçekilen golf arabaları, hasta nakliiçin arabalar, kızaklar dahil) Tehlikeli
30.99.02 Hayvanlar tarafından çekilenaraçların imalatı (at, eşekarabası, fayton, vb.) Az Tehlikeli
30.99.90 Başka yerde sınıflandırılmamışdiğer ulaşım ekipmanlarınınimalatı Tehlikeli
31 Mobilya imalatı
31.0 Mobilya imalatı
31.01 Büro ve mağaza mobilyalarıimalatı
31.01.01 Büro, okul, ibadethane, otel,lokanta, sinema, tiyatro vb. kapalıalanlar için mobilya imalatı (taş,beton, seramikten olanlar hariç)(vestiyer, dosya dolapları,mihraplar, minberler, kürsüler,öğrenci sıraları, büro tipisandalye ve koltuklar, vb.) Tehlikeli
31.01.02 Laboratuvarlar ve teknikbürolar için tezgahların vemobilyaların imalatı (mikroskopmasaları, laboratuvar masaları(vitrinli, gaz memeli, musluktertibatlı, vb. olsun olmasın),çeker ocaklar, teçhizatsız çizimmasaları, vb.) Tehlikeli
31.01.03 Mağazalar için tezgah, banko,vitrin, raf, çekmeceli dolap vb.özel mobilya imalatı(laboratuvarlar ve teknik bürolariçin olanlar hariç) Tehlikeli
31.01.04 Büro mobilyalarınıniskeletlerinin imalatı Tehlikeli
31.02 Mutfak mobilyalarınınimalatı
31.02.01 Mutfak mobilyalarınınimalatı Tehlikeli
31.03 Yatak imalatı
31.03.01 Yatak imalatı (yatakdestekleri, kauçuk şişme yatak vesu yatağı hariç) Tehlikeli
31.03.02 Yatak desteklerinin imalatı(yaylı veya çelik tel ağlı ahşapveya metal iskeletler, ahşap latalıdöşenmiş somya bazaları, somya,karyola, vb.) Tehlikeli
31.09 Diğer mobilyaların imalatı
31.09.01 Mobilyaların boyanması,verniklenmesi, cilalanması vb.tamamlayıcı işlerin yapılması Çok Tehlikeli
31.09.02 Sandalyelerin, koltukların vb.döşenmesi gibi tamamlayıcı işlerinyapılması (büro ve evmobilyalarının yeniden kaplanmasıhariç) Tehlikeli
31.09.03 Dikiş makinesi, TV, bilgisayar,vb. için dolap, sehpa, vb.mobilyaların imalatı Tehlikeli
31.09.04 Yatak odası, yemek odası, banyodolabı, genç ve çocuk odası takımı,gardırop, vestiyer, vb. imalatı(gömme dolap, masa, zigon, vb.dahil) Tehlikeli
31.09.05 Sandalye, koltuk, kanepe,çekyat, divan, vb iskeletlerininimalatı (iskeletçiler) (plastikolanlar ile bürolarda kullanılanlarhariç) Tehlikeli
31.09.06 Park ve bahçelerde kullanılanbank, masa, tabure, sandalye,koltuk, vb. mobilyaların imalatı(plastik olanlar hariç) Tehlikeli
31.09.07 Sandalye, koltuk, kanepe,oturma takımı, çekyat, divan,markiz, vb. imalatı (plastikolanlar ile bürolarda ve park vebahçelerde kullanılanlarhariç) Tehlikeli
31.09.08 Plastikten bank, masa, tabure,sandalye vb. mobilyalarınimalatı Tehlikeli
32 Diğer imalatlar
32.1 Mücevherat, bijuteri eşyalarıve ilgili ürünlerin imalatı
32.11 Madeni para basımı
32.11.01 Madeni para basımı Tehlikeli
32.12 Mücevher ve benzeri eşyalarınimalatı
32.12.01 Değerli metallerden takı vemücevherlerin imalatı (değerlimetallerle baskı, yapıştırma vb.yöntemlerle giydirilmiş adimetallerden olanlar dahil) Tehlikeli
32.12.03 Değerli metallerden yapılanteknik ve laboratuvar malzemeleriimalatı (maden eritme kapları,spatulalar, elektrolitik kaplamaanotları, vb. dahil) Tehlikeli
32.12.04 İnci ve değerli doğal taşlarınişlenmesi ve değerli taşlardan takıve mücevher ile bunlarınparçalarının imalatı (sentetik veyayeniden oluşturulmuş olanlardahil) Tehlikeli
32.12.06 Değerli olsun olmasın metaleşyalar üzerine oyma ve kabartmayapılması faaliyetleri Tehlikeli
32.12.07 Sanayi elmaslarınınişlenmesi Tehlikeli
32.12.08 Değerli metallerden veyadeğerli metallerle preslenerekkaplanmış adi metallerden yemektakımı, çatal bıçak takımı, tuvaletmalzemesi, büro malzemesi, vb.malzemelerin imalatı Tehlikeli
32.13 İmitasyon (taklit) takılar veilgili eşyaların imalatı
32.13.01 İmitasyon (taklit) takılar veilgili eşyaların imalatı Tehlikeli
32.2 Müzik aletleri imalatı
32.20 Müzik aletleri imalatı
32.20.21 Elektronik müzik aletleri veyaklavyeli çalgıların imalatı(elektrik gücüyle ses üreten veyasesi güçlendirilen enstrümanlar)(dijital piyano, sintizayzır,elektrogitar, vb.) Tehlikeli
32.20.22 Diğer yaylı/telli müzikaletlerinin imalatı (saz, gitar,keman, vb.) Az Tehlikeli
32.20.23 Ağızları huni gibi genişleyenneviden olan boru esaslı müzikaletleri ile diğer üflemeli müzikaletlerinin imalatı (saksafon,flüt, trombon, borazan, vb.) Tehlikeli
32.20.24 Vurmalı çalgıların imalatı(trampet, davul, ksilofon, zil, kasvs.) Tehlikeli
32.20.25 Piyanolar ve diğer klavyeliyaylı/telli çalgıların imalatı Az Tehlikeli
32.20.26 Borulu ve klavyeli orglar,armonyumlar, akordiyonlar, ağızmızıkaları (armonikalar), tulum vb.çalgıların imalatı Az Tehlikeli
32.20.27 Müzik kutuları, orkestriyonlar,laternalar, çıngıraklar vb.imalatı Az Tehlikeli
32.20.28 Metronomlar, akort çatalları(diyapazonlar) ve akort düdükleri,müzik kutuları için mekanizmalar,müzik aleti telleri ile müzikaletlerinin parça veaksesuarlarının imalatı Az Tehlikeli
32.20.90 Başka yerde sınıflandırılmamışdiğer müzik aletlerininimalatı Az Tehlikeli
32.3 Spor malzemeleri imalatı
32.30 Spor malzemeleri imalatı
32.30.17 Kar kayakları, kayakayakkabıları, kayak botları, kayakbatonları, buz patenleri vetekerlekli patenler ile su kayağıaraçları, sörf tahtaları, rüzgarsörfleri vb. ekipmanlar ilebunların parçalarının imalatı(kaykaylar dahil) Tehlikeli
32.30.18 Jimnastik ve atletizm eşyalarıile form tutma salonlarına ait eşyave ekipmanların imalatı (atlamabeygiri, dambıl ve halterler, kürekçekme ve bisiklete binme aletleri,ciritler, çekiçler; boks çalışmatopları, boks veya güreş içinringler vb.) Tehlikeli
32.30.19 Spor amaçlı dağcılık, avcılıkveya balıkçılık eşyalarının imalatı(kasklar, olta kamışları, oltaiğneleri ve kancaları, otomatikolta makaraları, el kepçeleri,kelebek ağları, yapma balıklar,sinekler gibi suni yemler,kurşunlar, yapma kuşlar vb.) Tehlikeli
32.30.20 Spor veya açık hava oyunlarıiçin diğer eşyaların imalatı (bokseldiveni, spor eldiveni, yaylar,beyzbol ve golf sopaları ile top vediğer eşyaları, tenis masası,raket, ağ ve topları, tozluklar,bacak koruyucular, şişme ve diğerhavuzlar vb.) Tehlikeli
32.30.21 Top imalatı (beyzbol, futbol,basketbol ve voleybol için) Tehlikeli
32.4 Oyun ve oyuncak imalatı
32.40 Oyun ve oyuncak imalatı
32.40.01 Oyun kağıt ve kartlarınınimalatı (iskambil vb.) Tehlikeli
32.40.02 Bozuk para veya jetonla çalışanoyun makineleri ile bilardo içinkullanılan eşya ve aksesuarlarınimalatı (rulet vb. oyun makineleriile bilardo masa ve istekaları,isteka dayanakları, bilardotopları, tebeşirleri, toplu veyasürgülü puan sayaçları vb.) Tehlikeli
32.40.03 Yap boz, puzzle ve benzeriürünlerin imalatı (lego vb.dahil) Tehlikeli
32.40.04 İçi doldurulmuş oyuncakbebeklerin ve oyuncak hayvanlarınimalatı Az Tehlikeli
32.40.05 Oyuncak bebek, kukla vehayvanlar ile bunların giysi, parçave aksesuarlarının imalatı (içidoldurulmuş olanlar hariç) Tehlikeli
32.40.06 Lunapark, masa ve salonoyunları için gereçlerinimalatı Tehlikeli
32.40.07 Oyuncak müzik aletleriimalatı Tehlikeli
32.40.08 Binmek için tasarlanmıştekerlekli oyuncakların imalatı(plastik bisikletler ve üçtekerlekli bisikletler dahil) Tehlikeli
32.40.09 Oyun tahtaları (satranç, dama,dart, tavla tahtaları, okeyistekası, go vb.) ve tabu, monopolvb. oyunların imalatı Tehlikeli
32.40.10 Tekerlekli oyuncaklar, oyuncakbebek arabaları, oyuncak trenler vediğer küçültülmüş boyutlumodeller/maketler veya inşaat oyuntakımları, yarış setleri imalatı(motorlu olanlar, pres dökümoyuncaklar ve plastik diğeroyuncaklar dahil) Tehlikeli
32.40.11 Elektronik oyun imalatı(elektronik damalar, satranç vb.)(televizyonla birlikte kullanılanvideo oyun konsolları hariç) Tehlikeli
32.40.90 Başka yerde sınıflandırılmamışoyun ve oyuncakların imalatı Tehlikeli
32.5 Tıbbi ve dişçilik ile ilgiliaraç ve gereçlerin imalatı
32.50 Tıbbi ve dişçilik ile ilgiliaraç ve gereçlerin imalatı
32.50.01 Gözlük (göz kusurlarınıgiderici, düzeltici, koruyucu vediğer amaçlı), gözlük camı, kontaklens ile gözlük ve benzeri içinçerçeve ve çerçeve parçalarınınimalatı Tehlikeli
32.50.02 Suni uzuvlar, protez veortopedik ürünler ile bunlarınparça ve aksesuarlarının imalatı(suni eklem, dişçilikle ilgilibağlantı parçaları, ortopedikayakkabı ve korse, diş teli, tıbbiçivi, fıtık bağı vb.) Tehlikeli
32.50.03 Dişçilikte kullanılanaraç-gereç ve cihazların imalatı(dişçi aeratörleri dahil) (şırınga,iğne, katater, kanül ve benzerlerihariç) Tehlikeli
32.50.04 Tıbbi, cerrahi, dişçilik veyaveterinerlikle ilgili mobilyaların,berber koltukları ve benzerisandalyeler ile bunlarınparçalarının imalatı (ameliyat vetetkik masası, ayarlanabilirhastane yatağı, dişçi koltuğu, vb.)(X ışını masa ve koltuklarıhariç) Tehlikeli
32.50.06 Dişçi çimentosu, dişçilikmumları, dolgu maddesi, kemiktedavisinde kullanılan çimento, jelpreparat, steril adhezyon bariyeri,dikiş malzemesi (katgüt hariç),doku yapıştırıcısı, laminarya,emilebilir hemostatik, vb.imalatı Tehlikeli
32.50.07 Tıpta, cerrahide, dişçilikteveya veterinerlikte kullanılanşırınga, iğne, katater, kanül vebenzerlerinin imalatı Tehlikeli
32.50.08 Göz tedavisi ile ilgilicerrahi, tanı, test ve benzerialetlerin imalatı (korneaya aityuvarlak testereler, oftalmoskop,retinoskop, keratometreler,vb.) Tehlikeli
32.50.09 Mekano terapi cihazları, masajaletleri, psikolojik eğilim-testialetleri (tamamen hareketsiz mekanoterapi cihazları hariç), ozonterapi, oksijen terapi, aerosolterapi ve solunum cihazlarıimalatı Tehlikeli
32.50.10 Tıbbi, cerrahi veya laboratuvarsterilizasyon aletlerininimalatı Tehlikeli
32.50.11 Tansiyon aletleri,tansiyometreler, osilometreler,tıbbi endoskoplar, klinik veyaveterinerlik termometreleri, böbrekdiyaliz cihazları, transfüzyoncihazları (kan depolama için özelcam şişeler hariç) imalatı Tehlikeli
32.50.12 Anestezi cihaz ve aletleri,diyatermik cihazlar (ultrasoniklerdahil), ultrasonik litotripsialetleri ve laboratuvarlardakullanılan santrifüjlerinimalatı Tehlikeli
32.50.13 Diş laboratuvarlarınınfaaliyetleri (protez diş, metalkuron, vb. imalatı) Çok Tehlikeli
32.50.90 Tıpta, cerrahide, dişçilikteveya veterinerlikte kullanılan bys.diğer araç ve gereçlerinimalatı Tehlikeli
32.9 Başka yerde sınıflandırılmamışimalatlar
32.91 Süpürge ve fırça imalatı
32.91.01 Ev veya büro temizliği içinolan süpürge ve fırçaların imalatı(elektrikli olanlar hariç) Tehlikeli
32.91.02 Boyama, badana, duvar kağıdı vevernik fırçaları ile rulolarınınimalatı Tehlikeli
32.91.03 Diş fırçaları, saç fırçaları,tıraş fırçaları ve kişisel bakımiçin kullanılan diğer fırçalar ileresim fırçaları, yazı fırçaları vekozmetik fırçaların imalatı Tehlikeli
32.91.90 Başka yerde sınıflandırılmamışdiğer süpürge ve fırçaların imalatı(elektrikli olanlar hariç) Tehlikeli
32.99 Başka yerde sınıflandırılmamışdiğer imalatlar
32.99.01 Terzi mankeni, el kalbur veeleği, yapma çiçek, meyve vebitkiler, şaka ve sihirbazlıkbenzeri eşya, koku püskürtücülerive mekanizmaları, tabut vb.eşyaların imalatı (gelin çiçeğidahil) Tehlikeli
32.99.02 Kot vb. baskı düğmeleri,çıtçıtlar, düğmeler, fermuarlar vb.imalatı (düğme formları ve fermuarparçaları dahil) Tehlikeli
32.99.03 Pipo, sigara ağızlıkları, Oltuveya lüle taşından tespih vb.imalatı Tehlikeli
32.99.04 Mekanik olsun veya olmasın herçeşit dolma kalem, tükenmez vekurşun kalem ile boya kalemi,pastel boya imalatı (kalem ucu vekurşun kalem içleri dahil) Tehlikeli
32.99.06 Peruk, takma saç, takma sakal,takma kaş vb. imalatı Az Tehlikeli
32.99.07 Şemsiyeler, güneş şemsiyeleri,baston ve koltuklu baston, koltukdeğneği vb. imalatı (parçalarıdahil) Tehlikeli
32.99.08 Tarih verme, damga, mühür veyanumara verme kaşeleri, numeratör,elle çalışan basım aletleri,kabartma etiketleri, el baskısetleri, hazır daktilo şeritleri veıstampaların imalatı Az Tehlikeli
32.99.09 Koruyucu amaçlı solunumekipmanları ve gaz maskelerininimalatı (tedavi edici olanlarhariç) Tehlikeli
32.99.10 Ateşe dayanıklı ve koruyucugüvenlik kıyafetleri ve başlıklarıile diğer güvenlik ürünlerininimalatı (solunum ekipmanları ve gazmaskeleri hariç) Tehlikeli
32.99.11 Mantar can simitlerininimalatı Tehlikeli
32.99.13 Termos ve vakumlu kaplarınimalatı Tehlikeli
32.99.14 Tebeşir imalatı (yazı, çizimveya terzi tebeşiri) Tehlikeli
32.99.15 Suni balmumu ile suni mumlarınve müstahzar mumların imalatı Tehlikeli
32.99.16 Yazı veya çizim tahtalarıimalatı Tehlikeli
32.99.17 Sigara çakmakları ve diğerçakmaklar ile çabuk tutuşan(piroforik) alaşımların imalatı(çakmaklar için kap hacmi ? 300cm3sıvı veya sıvılaştırılmış gazyakıtları dahil) Tehlikeli
32.99.18 Fildişi, kemik, boynuz, sedefgibi hayvansal malzemelerden oymaeşyaların imalatı Tehlikeli
32.99.90 Başka yerde sınıflandırılmamışdiğer imalatlar (bağırsak (ipekböceği guddesi hariç), kursak vemesaneden mamul eşyalar dahil,tıbbi amaçlı steril olanlarhariç) Tehlikeli
33 Makine ve ekipmanların kurulumuve onarımı
33.1 Fabrikasyon metal ürünlerin,makinelerin ve ekipmanlarınonarımı
33.11 Fabrikasyon metal ürünlerinonarımı
33.11.01 Metal boru ve boru hatları ilepompa istasyonlarının bakım veonarımı Tehlikeli
33.11.02 Ateşli silahların ve savaşgereçlerinin bakım ve onarımı (sporve eğlence amaçlı silahlarınonarımı dahil) Tehlikeli
33.11.03 Buhar kazanları veya buharjeneratörlerinin bakım veonarımı Tehlikeli
33.11.04 Merkezi ısıtma sıcak sukazanları (boyler) ve radyatörlerinbakım ve onarımı Tehlikeli
33.11.10 Metal tankların, rezervuarlarınve muhafaza kaplarının(konteynerler dahil) onarımı Tehlikeli
33.11.11 Nükleer reaktörlerin bakım veonarımı Çok Tehlikeli
33.11.90 Başka yerde sınıflandırılmamışmetal ürünlerin bakım veonarımı Tehlikeli
33.12 Makinelerin onarımı
33.12.02 Tarım ve ormancılıkmakinelerinin bakım ve onarımı(traktörlerin bakım ve onarımıhariç) Tehlikeli
33.12.03 Motor ve türbinlerin bakım veonarımı (hidrolik, rüzgar, gaz, su,buhar türbinleri) (gemi ve teknemotorları dahil, motorlu karataşıtı ve motosiklet motorlarıhariç) Tehlikeli
33.12.04 Sanayi fırınlarının,ocaklarının ve ocak brülörlerininbakım ve onarımı Tehlikeli
33.12.05 Kaldırma ve taşımaekipmanlarının bakım veonarımı Tehlikeli
33.12.06 Sanayi tipi soğutma vehavalandırma ekipmanlarının bakımve onarımı Tehlikeli
33.12.07 Tartı aletlerinin bakım veonarımı Az Tehlikeli
33.12.08 Madencilik, inşaat, petrol vegaz sahalarında kullanılanmakinelerin bakım ve onarımı Tehlikeli
33.12.09 Tarım ve ormancılıktakullanılan motokültörler vetraktörlerin bakım ve onarımı Tehlikeli
33.12.10 Akışkan gücü ile çalışanekipmanlar, pompalar, kompresörlerile valflerin ve vanaların bakım veonarımı (akaryakıt pompalarınıntamiri dahil) Tehlikeli
33.12.11 Metal işleme makinelerinin vetakım tezgahlarının bakım veonarımı (CNC olanlar dahil) Tehlikeli
33.12.12 Motorlu veya pnömatik (havabasınçlı) el aletlerinin onarımı(yuvarlak/vargel/zincir testere,matkap, pnömatik veya motorlu metalkesme makası, darbeli cıvataanahtarı vb.) Tehlikeli
33.12.13 Elektrikli kaynak ve lehimaletlerinin bakım ve onarımı Tehlikeli
33.12.14 Metalürji makinelerinin bakımve onarımı Tehlikeli
33.12.15 Gıda, içecek ve tütün işlememakinelerinin bakım ve onarımı Tehlikeli
33.12.16 Tekstil, giyim eşyası ve deriüretim makinelerinin bakım veonarımı (triko makinelerininonarımı dahil) Tehlikeli
33.12.17 Kağıt, karton ve mukavvaüretiminde kullanılan makinelerinbakım ve onarımı Tehlikeli
33.12.18 Büro ve muhasebe makinelerinbakım ve onarımı (daktilo, yazarkasa, fotokopi makineleri, hesapmakineleri, vb.) Az Tehlikeli
33.12.19 Ağaç, mantar, taş, sert kauçukveya benzeri sert malzemeleriişlemede kullanılan takımtezgahlarının bakım ve onarımı (CNColanlar dahil) Tehlikeli
33.12.21 Sıvılar için filtreleme ya datemizleme makineleri veaparatlarının bakım ve onarımı Az Tehlikeli
33.12.27 Kesici aletler ile elaletlerinin bakım ve onarımı(matbaa giyotini, şerit testere, eltesteresi, çapa, orak vb. bileylemeve çarkçılık dahil) (motorlu vepnömatik olanlar hariç) Tehlikeli
33.12.28 Plastik ve kauçuk imalatında veişlenmesinde kullanılan makinelerinbakım ve onarımı Tehlikeli
33.12.29 Endüstriyel rulmanların,dişlilerin, dişli takımlarının vetahrik tertibatı elemanlarınınbakım ve onarımı Tehlikeli
33.12.30 Tarımsal amaçlı kullanılanrömorkların bakım ve onarımı Tehlikeli
33.12.90 Başka yerde sınıflandırılmamışdiğer makinelerin bakım ve onarımı(yangın söndürme tüplerinin dolumuve tamiri dahil) Tehlikeli
33.13 Elektronik veya optikekipmanların onarımı
33.13.01 Ölçme, test ve seyrüsefer aletve cihazlarının bakım veonarımı Az Tehlikeli
33.13.02 Işınlama, elektromedikal veelektroterapi ekipmanlarının bakımve onarımı Çok Tehlikeli
33.13.03 Profesyonel optik aletlerin vefotoğrafçılık ekipmanlarının bakımve onarımı (tüketici elektronikürünlerinin onarımı hariç) Tehlikeli
33.13.04 Diğer profesyonel elektronikekipmanların bakım ve onarımı Tehlikeli
33.14 Elektrikli ekipmanlarınonarımı
33.14.01 Güç transformatörleri, dağıtımtransformatörleri ve özeltransformatörlerin bakım ve onarımı(elektrik dağıtım ve kontrolcihazları dahil) Tehlikeli
33.14.02 Elektrik motorları,jeneratörler ve motor jeneratörsetlerinin bakım ve onarımı(bobinlerin tekrar sarımıdahil) Tehlikeli
33.14.03 Diğer profesyonel elektrikliekipmanların bakım ve onarımı Tehlikeli
33.15 Gemilerin ve teknelerin bakımve onarımı
33.15.01 Gemilerin ve teknelerin bakımve onarımı (yüzen yapılar, sandal,kayık, vb. bakım ve onarımı ilebunların kalafatlanması dahil) Çok Tehlikeli
33.16 Hava taşıtlarının ve uzayaraçlarının bakım ve onarımı
33.16.01 Hava taşıtlarının ve uzayaraçlarının bakım ve onarımı(fabrikalarda yapılan dönüştürme,elden geçirme ve yeniden üretmehariç) Tehlikeli
33.17 Diğer ulaşım ekipmanlarınınbakım ve onarımı
33.17.01 Demir yolu lokomotiflerinin vevagonlarının bakım ve onarımı Tehlikeli
33.17.90 Başka yerde sınıflandırılmamışdiğer ulaşım ekipmanlarının bakımve onarımı (at arabaları ve dörttekerlekli yük arabalarının bakımve onarımı dahil) Az Tehlikeli
33.19 Diğer ekipmanların onarımı
33.19.01 Tentelerin, kampekipmanlarının, çuvalların vebalıkçılık ağları gibi diğer hazırtekstil malzemelerinin onarımı Az Tehlikeli
33.19.02 Halatlar, gemi çarmık vehalatları ile yelken bezleri ve bezastarlı muşambaların onarımı Az Tehlikeli
33.19.90 Başka yerde sınıflandırılmamışdiğer ekipmanların onarımı (ahşapkonteyner, gemi fıçı ve varilleri,madeni para ile çalışan oyunmakineleri, değirmentaşı, bilemetaşı vs.) Az Tehlikeli
33.2 Sanayi makine ve ekipmanlarınınkurulumu
33.20 Sanayi makine ve ekipmanlarınınkurulumu
33.20.33 Tarımsal amaçlı sanayi makineve ekipmanlarının kurulumu Tehlikeli
33.20.34 Kaldırma ve taşımaekipmanlarının kurulumu (asansörlerve yürüyen merdivenler hariç) Tehlikeli
33.20.35 Motor ve türbinlerin (havataşıtı, motorlu kara taşıtı vemotosiklet motorları hariç) vepompa ve kompresörlerinkurulumu Tehlikeli
33.20.36 Metallerin işlenmesinde,kesilmesinde veşekillendirilmesinde kullanılanmakinelerin kurulum hizmetleri Tehlikeli
33.20.37 Metalürji için sanayimakinelerinin ve ekipmanlarınınkurulum hizmetleri Tehlikeli
33.20.38 Maden, taşocağı ve inşaatlardakullanılan makinelerinkurulumu Tehlikeli
33.20.39 Gıda, içecek ve tütün işlemeiçin sanayi makinelerinin veekipmanlarının kurulumhizmetleri Tehlikeli
33.20.40 Tekstil, giyim eşyası ve deriüretimi için sanayi makinelerininve ekipmanlarının kurulumhizmetleri Tehlikeli
33.20.41 Kağıt ve mukavva üretimi içinsanayi makinelerinin veekipmanlarının kurulumhizmetleri Tehlikeli
33.20.42 Sanayi fabrikalarında cam veseramik boruların ve hatlarınkurulumu Tehlikeli
33.20.43 Değirmencilikte kullanılanmakinelerin kurulumu Tehlikeli
33.20.44 Metal muhafaza tanklarının vesarnıçların kurulumu Tehlikeli
33.20.45 Sanayi tipi ısıtma,iklimlendirme ve soğutma cihaz veekipmanlarının kurulumu Tehlikeli
33.20.46 Genel amaçlı makinelerinkurulum hizmetleri (tartma,filtreleme, damıtma, paketleme,şişeleme, püskürtme, buhar/kumpüskürtme, kalenderleme içinolanlar ile büro ve muhasebemakinelerinin kurulum hizmetleridahil) Tehlikeli
33.20.48 Ağaç, mantar, taş, sert kauçukveya benzeri sert malzemeleriişlemede kullanılan takımtezgahlarının kurulumhizmetleri Tehlikeli
33.20.49 Plastik ve kauçuk üretimi içinsanayi makinelerinin veekipmanlarının kurulumhizmetleri Tehlikeli
33.20.50 Profesyonel tıbbi makineler,hassas ve optik aletler veprofesyonel elektronik ekipmanlarınkurulum hizmetleri Tehlikeli
33.20.51 Elektrikli ekipmanların kurulumhizmetleri (elektrik motorları,jeneratörler ve transformatörlerin,elektrik dağıtım ve kontrolcihazları ile diğer elektrikliekipmanların kurulumu (yollar, vb.için elektrikli sinyalizasyonekipmanları hariç)) Tehlikeli
33.20.52 Fabrikasyon metal ürünlerinkurulum hizmetleri (buharjeneratörlerinin kurulum hizmetlerive sanayi tesislerindeki metal borusistemlerinin kurulumu dahil,merkezi ısıtma sıcak su kazanları(boylerleri) ile makine veekipmanlar hariç) Tehlikeli
33.20.53 Endüstriyel işlem kontrolekipmanlarının kurulum hizmetleri(endüstriyel işlem kontrolekipmanlarının ve otomatik üretimtesislerinin tasarımı ve montajı,endüstriyel zaman ölçüm alet vecihazlarının kurulumu) (otomasyondestekliler dahil) Tehlikeli
33.20.54 Sanayi fırınlarının ve ocakbrülörlerinin (ocakateşleyicilerinin) kurulumu Tehlikeli
33.20.90 Başka yerde sınıflandırılmamışdiğer sanayi makine veekipmanlarının kurulum hizmetleri(matbaa makineleri ve çimentoimalatında kullanılan makilerinkurulumu dahil) Tehlikeli
D ELEKTRİK, GAZ, BUHAR VEİKLİMLENDİRME ÜRETİMİ VEDAĞITIMI
35 Elektrik, gaz, buhar vehavalandırma sistemi üretim vedağıtımı
35.1 Elektrik enerjisinin üretimi,iletimi ve dağıtımı
35.11 Elektrik enerjisi üretimi
35.11.19 Elektrik enerjisi üretimi Çok Tehlikeli
35.12 Elektrik enerjisininiletimi
35.12.13 Elektrik enerjisinin iletimi(elektrik üretim kaynağındandağıtım sistemine aktaran iletimsistemlerinin işletilmesi) Çok Tehlikeli
35.13 Elektrik enerjisinindağıtımı
35.13.01 Elektrik enerjisinin dağıtımı(üretim kaynağından veya iletimsisteminden son kullanıcıya iletimsistemiyle taşınan elektrikenerjisi dağıtım sistemininişletilmesi) Çok Tehlikeli
35.13.02 Elektrik sayaçlarının bakım veonarımı Tehlikeli
35.14 Elektrik enerjisininticareti
35.14.01 Diğer işletmeler tarafındanişletilen güç dağıtım sistemleriaracılığı ile elektrik satışınıdüzenleyen elektrik komisyoncularıve acentelerinin faaliyetleri Az Tehlikeli
35.14.02 Kullanıcılara yönelik elektrikticareti (komisyoncular veacenteler hariç) Az Tehlikeli
35.14.03 Elektrik için elektrik veiletim kapasitesi değiştirmefaaliyetleri Çok Tehlikeli
35.2 Gaz imalatı; ana şebekeüzerinden gaz yakıtlarındağıtımı
35.21 Gaz imalatı
35.21.01 Doğalgaz dahil, çeşitli türdekigazlardan arındırma, karıştırma,vb. işlemlerle kalorifik değerdegazlı yakıtların üretimi Çok Tehlikeli
35.21.02 Kömürün karbonlaştırılması,tarımsal yan ürün veya atıklarındangaz üretimi Çok Tehlikeli
35.22 Ana şebeke üzerinden gazyakıtların dağıtımı
35.22.01 Ana şebeke üzerinden gazyakıtların dağıtımı (her çeşitgazlı yakıtın, ana boru sistemiyledağıtımı ve tedariki) Çok Tehlikeli
35.22.02 Gaz sayaçlarının bakım veonarımı Az Tehlikeli
35.23 Ana şebeke üzerinden gazticareti
35.23.01 Ana şebeke üzerindenkullanıcılara yönelik gaz ticareti(komisyoncular ve acentelerhariç) Az Tehlikeli
35.23.02 Diğer işletmeler tarafındanişletilen gaz dağıtım sistemleriaracılığıyla, gaz satışınıdüzenleyen gaz komisyoncuları veyaacentelerinin faaliyetleri Az Tehlikeli
35.3 Buhar ve iklimlendirmetemini
35.30 Buhar ve iklimlendirmetemini
35.30.21 Buhar ve sıcak su üretimi,toplanması ve dağıtımı Çok Tehlikeli
35.30.22 Soğutulmuş hava ve soğutulmuşsu üretim ve dağıtımı (buz üretimidahil) Tehlikeli
E SU TEMİNİ; KANALİZASYON, ATIKYÖNETİMİ VE İYİLEŞTİRMEFAALİYETLERİ
36 Suyun toplanması, arıtılması vedağıtılması
36.0 Suyun toplanması, arıtılması vedağıtılması
36.00 Suyun toplanması, arıtılması vedağıtılması
36.00.02 Suyun toplanması, arıtılması vedağıtılması Çok Tehlikeli
36.00.03 Su sayaçlarının bakım veonarımı Az Tehlikeli
37 Kanalizasyon
37.0 Kanalizasyon
37.00 Kanalizasyon
37.00.01 Kanalizasyon (kanalizasyonatıklarının uzaklaştırılması vearıtılması, kanalizasyonsistemlerinin ve atık su arıtmatesislerinin işletimi, foseptikçukurların ve havuzlarınboşaltılması ve temizlenmesi,seyyar tuvalet faaliyetlerivb.) Çok Tehlikeli
38 Atığın toplanması, ıslahı vebertarafı faaliyetleri; maddeleringeri kazanımı
38.1 Atıkların toplanması
38.11 Tehlikesiz atıklarıntoplanması
38.11.01 Tehlikesiz atıkların toplanması(çöpler, geri dönüştürülebilirmaddeler, tekstil atıkları, vb.)(inşaat ve yıkım atıkları, çalı,çırpı, moloz gibi enkazlarhariç) Tehlikeli
38.11.02 İnşaat ve yıkım atıklarının,çalı, çırpı, moloz gibi enkazlarıntoplanması ve kaldırılması Tehlikeli
38.11.03 Tehlikesiz atık transferistasyonlarının işletilmesi Tehlikeli
38.12 Tehlikeli atıklarıntoplanması
38.12.01 Tehlikeli atıkların toplanması(patlayıcı, oksitleyici, yanıcı,zehirli, aşındırıcı, bulaşıcı veinsan sağlığı için zararlıatıkların ve maddelerin toplanmasıfaaliyetleri) (nükleer atıklar,biyokimyasal atıklar, kullanılmışpiller vb.) Çok Tehlikeli
38.2 Atıkların ıslahı vebertarafı
38.21 Tehlikesiz atıkların ıslahı vebertaraf edilmesi
38.21.01 Tehlikesiz atıkların ıslahı vebertaraf edilmesi ve bertarafı içindepolama alanlarınınişletilmesi Tehlikeli
38.22 Tehlikeli atıkların ıslahı vebertaraf edilmesi
38.22.01 Tehlikeli atıkların ıslahı vebertaraf edilmesi (tehlikeliatıkların ıslahını yapan tesislerinişletilmesi, zararlı atıkların yokedilmesi için kullanılmış mallarınbertarafı vb. faaliyetler)(radyoaktif atıklar hariç) Çok Tehlikeli
38.22.02 Radyoaktif atıkların ıslahı vebertaraf edilmesi Çok Tehlikeli
38.3 Materyallerin gerikazanımı
38.31 Hurdaların parçalaraayrılması
38.31.01 Gemi ve yüzer yapılarınhurdalarının materyallerinin gerikazanımı amacıyla parçalaraayrılması (sökülmesi) Çok Tehlikeli
38.31.02 Hurdaların geri kazanımamacıyla parçalara ayrılması(otomobil, bilgisayar, televizyonvb. donanımlar) (gemiler ve yüzeryapılar ile satmak içinkullanılabilir parçalar oluşturmakamacıyla sökme hariç) Çok Tehlikeli
38.32 Tasnif edilmiş materyalleringeri kazanımı
38.32.01 Tasnif edilmiş metal atıklar,hurdalar ve diğer parçalarıngenellikle mekanik veya kimyasaldeğişim işlemleri ile gerikazanılması Çok Tehlikeli
38.32.02 Tasnif edilmiş metal dışıatıklar, hurdalar ve diğerparçaların genellikle mekanik veyakimyasal değişim işlemleri ile gerikazanılması Çok Tehlikeli
39 İyileştirme faaliyetleri vediğer atık yönetimi hizmetleri
39.0 İyileştirme faaliyetleri vediğer atık yönetimi hizmetleri
39.00 İyileştirme faaliyetleri vediğer atık yönetimi hizmetleri
39.00.01 İyileştirme faaliyetleri vediğer atık yönetimi hizmetleri(kirletilmiş toprak ve yeraltısularının temizlenmesi, karamayınlarının temizlenmesi,vb.) Çok Tehlikeli
F İNŞAAT
41 Bina inşaatı
41.1 İnşaat projeleriningeliştirilmesi
41.10 İnşaat projeleriningeliştirilmesi
41.10.01 Bina projeleriningeliştirilmesi (satışa yönelik binaprojeleri için mali, teknik vefiziksel araçların bir arayagetirilmesi suretiyle konut veyadiğer amaçlı kullanıma yönelik binaprojelerinin organize edilmesi)(yapı kooperatifleri hariç) Az Tehlikeli
41.10.02 Konut yapı kooperatiflerininfaaliyetleri Çok Tehlikeli
41.10.03 İşyeri yapı kooperatiflerininfaaliyetleri Çok Tehlikeli
41.2 İkamet amaçlı olan veya ikametamaçlı olmayan binalarıninşaatı
41.20 İkamet amaçlı olan veya ikametamaçlı olmayan binalarıninşaatı
41.20.01 İkamet amaçlı olmayan binalarıninşaatı (fabrika, atölye vb. sanayiüretimini amaçlayan binalar ilehastane, okul, otel, işyeri,mağaza, alışveriş merkezi, lokanta,kapalı spor tesisi, cami, kapalıotopark, tuvalet, vb. inşaatı) Çok Tehlikeli
41.20.02 İkamet amaçlı binaların inşaatı(müstakil konutlar, birden çokailenin oturduğu binalar,gökdelenler vb.nin inşaatı) (ahşapbinaların inşaatı hariç) Çok Tehlikeli
41.20.03 Prefabrik binalar içinbileşenlerin alanda birleştirilmesive kurulması Çok Tehlikeli
41.20.04 İkamet amaçlı ahşap binalarıninşaatı Çok Tehlikeli
41.20.05 Mevcut ikamet amaçlı olan veyaikamet amaçlı olmayan binalarınyeniden düzenlenmesi veyayenilenmesi (büyük çaplırevizyon) Çok Tehlikeli
42 Bina dışı yapılarıninşaatı
42.1 Kara ve demir yollarınıninşaatı
42.11 Kara yolları ve otoyollarıninşaatı
42.11.01 Oto yollar, kara yolları, şehiriçi yollar ve diğer araç veya yayayollarının inşaatı Çok Tehlikeli
42.11.02 Yol yüzeylerinin asfaltlanmasıve onarımı, kaldırım, kasis,bisiklet yolu vb.lerin inşaatı,yolların vb. yüzeylerin boyaylaişaretlenmesi, yol bariyeri, trafikişaret ve levhaları vb.nin kurulumugibi yol, tünel vb. yerlerdekiyüzey işleri Çok Tehlikeli
42.11.03 Havaalanı pisti inşaatı Çok Tehlikeli
42.12 Demir yolları ve metrolarıninşaatı
42.12.01 Demir yolları ve metrolarıninşaatı (bakım ve onarımıdahil) Çok Tehlikeli
42.13 Köprüler ve tünellerininşaatı
42.13.01 Köprülerin inşaatı(yükseltilmiş karayolları-viyadükler dahil) Çok Tehlikeli
42.13.02 Tünel inşaatı Çok Tehlikeli
42.2 Hizmet projelerinininşaatı
42.21 Akışkanlar için hizmetprojelerinin inşaatı
42.21.01 Akışkanlar için uzun mesafeboru hatlarının inşaatı (petrolürünleri ve gaz taşımacılığı ile suve diğer ürünlerin taşımacılığınayönelik karada ve deniz altındauzun mesafe boru hattı) Çok Tehlikeli
42.21.02 Su kuyusu açma ve septik sistemkurulum faaliyetleri (kuyu,artezyen vb.) Çok Tehlikeli
42.21.03 Ana su şebekeleri ve su hatlarıile su arıtma tesisleri,kanalizasyon bertaraf tesisleri vepompa istasyonları inşaatı (sulamasistemleri (kanallar) dahil) Çok Tehlikeli
42.21.05 Akışkanlar için kısa mesafe(yerel) boru hatlarının inşaatı(petrol ürünleri ve gaztaşımacılığı ile su, kanalizasyon,sıcak su, buhar ve diğer ürünlerintaşımacılığına yönelik kısa mesafeboru hattı) Çok Tehlikeli
42.22 Elektrik ve telekomünikasyoniçin hizmet projelerinininşaatı
42.22.01 Uzun mesafe elektrik vetelekomünikasyon (iletişim)hatlarının inşaatı (uzun mesafeyüksek gerilim elektrik iletimhatları ile uzun mesafe yerüstü/altı veya deniz altıtelekomünikasyon iletimhatları) Çok Tehlikeli
42.22.02 Enerji santralleri inşaatı(hidroelektrik santrali, termiksantral, nükleer enerji üretimsantralleri vb.) Çok Tehlikeli
42.22.04 Kısa mesafe (yerel) elektrik vetelekomünikasyon (iletişim)hatlarının inşaatı (anten dahililetim kuleleri ve trafoistasyonları ve yerel sınırlariçerisinde dağıtım alt istasyonlarıvb.) Çok Tehlikeli
42.22.05 Telekomünikasyon şebeke veağlarının bakım ve onarımı Çok Tehlikeli
42.9 Bina dışı diğer yapılara aitprojelerin inşaatı
42.91 Su projeleri inşaatı
42.91.01 Kıyı ve liman inşaatları veilgili hidromekanik yapılarıninşaatı (su yolları, liman ve yatlimanları, kıyı düzenlemeleri,iskele ve rıhtımlar, dalgakıranlar,kanallar vb. yapılar) Çok Tehlikeli
42.91.02 Su ve su zemininin taranması vetemizlenmesi (deniz, nehir, gölvb.) Çok Tehlikeli
42.91.03 Tersane, dok ve kanal havuzuinşaatı (gemi inşaatı ve tamiriiçin) Çok Tehlikeli
42.91.04 Baraj ve bentlerin inşaatı Çok Tehlikeli
42.99 Başka yerde sınıflandırılmamışbina dışı diğer yapılara aitprojelerin inşaatı
42.99.01 Açık havada yapılan sporlarauygun tesislerin ve eğlencealanları yapılarının inşaatı (golfsahaları, açık stadyumlar, teniskortları, atletizm sahaları, plajtesisi, dağ barınakları, eğlenceparkları vb.) Çok Tehlikeli
42.99.02 Madencilik ve imalat sanayisiyapılarının inşaatı (sarım mili vekuleleri, maden yükleme ve boşaltmaistasyonları, rafineriler, kimyasaltesisler vb.) Çok Tehlikeli
42.99.03 Başka yerde sınıflandırılmamışbina dışı diğer yapıların inşaatı(arazi iyileştirilmesi ile birliktearazinin parsellemesi dahil,iyileştirme yapılmaksızınparselleme hariç) Çok Tehlikeli
42.99.04 Doğalgaz işleme tesisleriinşaatı Çok Tehlikeli
43 Özel inşaat faaliyetleri
43.1 Yıkım ve şantiyeninhazırlanması
43.11 Yıkım
43.11.01 Yıkım işleri (binaların vediğer yapıların yıkılması vesökülmesi) Çok Tehlikeli
43.12 Şantiyenin hazırlanması
43.12.01 Zemin ve arazi hazırlama,alanın temizlenmesi ile kazı vehafriyat işleri (tarımsal arazininhazırlanması, dinamitleme vekayaların kaldırılması, inşaat,tarım vb. alanların drenajı,hafriyat, kazı, dolgu vb. işler)(madencilik için yapılanlarhariç) Çok Tehlikeli
43.12.02 Maden sahalarının hazırlanması(tünel açma dahil, petrol ve gazsahaları için olanlar hariç) Çok Tehlikeli
43.13 Test sondajı ve delme
43.13.01 Test sondajı ve delme (inşaat,jeofizik, jeolojik vb. amaçlar içintest sondajı ve delme işleri ileörnekleme sondajı) (madenciliklebağlantılı olarak gerçekleştirilentest sondajı hariç) Çok Tehlikeli
43.2 Elektrik tesisatı, sıhhitesisat ve diğer inşaat tesisatıfaaliyetleri
43.21 Elektrik tesisatı
43.21.01 Bina ve bina dışı yapıların(ulaşım için aydınlatma vesinyalizasyon sistemleri hariç)elektrik tesisatı, kablolutelevizyon ve bilgisayar ağıtesisatı ile konut tipi antenler(uydu antenleri dahil), elektrikligüneş enerjisi kollektörleri,elektrik sayaçları, yangın vehırsızlık alarm sistemleri vb.kurulumu Çok Tehlikeli
43.21.03 Karayolları, demiryolları vediğer raylı yolların, liman vehavaalanlarının aydınlatma vesinyalizasyon sistemlerinintesisatı (havaalanı pistiaydınlatmasının tesisatıdahil) Çok Tehlikeli
43.22 Sıhhi tesisat, ısıtma veiklimlendirme tesisatı
43.22.01 Bina veya diğer inşaatprojelerinde ısıtma, havalandırma,soğutma ve iklimlendirmesistemlerinin tesisatı (ev tipiboyler (kombi, kazan vb.) vebrülörlerin bakım, onarım vekurulumu ile elektriksiz güneşenerjisi kolektörlerinin kurulumudahil) Çok Tehlikeli
43.22.03 Bina ve diğer inşaatprojelerinde su ve kanalizasyontesisatı ve onarımı (yağmurlamasistemlerinin kurulumu dahil sıhhitesisat işleri, yangın söndürmesistemlerinin kurulumu,kanalizasyon tesisatı döşeme işlerivb.) Çok Tehlikeli
43.22.05 Gaz tesisatı faaliyetleri(hastanelerdeki oksijen gazı teminiiçin kurulum işleri dahil) Çok Tehlikeli
43.29 Diğer inşaat tesisatı td>
43.29.01 Asansörlerin, yürüyenmerdivenlerin, yürüyen yolların,otomatik ve döner kapıların bakımve onarımı dahil kurulumişleri Çok Tehlikeli
43.29.02 Başka yerde sınıflandırılmamışdiğer tesisat işleri(paratonerlerin, tabelaların(ışıklı olsun veya olmasın), storve güneşliklerin montaj işlerivb.) Çok Tehlikeli
43.29.03 Isı, ses veya titreşim yalıtımıile diğer inşaat tesisatı işleri(mantolama ve vakumlu temizlemesistemlerinin kurulumu dahil) Çok Tehlikeli
43.29.05 Parmaklık ve korkuluk tesisatıişleri (metal yangınmerdivenlerinin kurulumudahil) Çok Tehlikeli
43.3 Binanın tamamlanması vebitirilmesi
43.31 Sıva işleri
43.31.01 Sıva işleri (binalarda veyadiğer inşaatlarda iç ve dış sıvaveya alçı sıva işleri ile alçıpanişleri vb.) Çok Tehlikeli
43.32 Doğrama tesisatı
43.32.01 Hazır mutfaklar, mutfaktezgahları, gömme dolaplar, içmerdivenler ile ince tahta, lambrive benzerlerinin montajıişleri Tehlikeli
43.32.02 Herhangi bir malzemeden yapılankapı ve pencere kasaları, kapılar(zırhlı kapılar dahil, otomatik vedöner kapılar hariç), pencereler,kepenkler, panjurlar, garajkapıları ve benzerlerininmontajı Tehlikeli
43.32.03 Seyyar bölme ve metal yapıüzerine asma tavan montaj işleriile diğer doğrama tesisatıişleri Tehlikeli
43.33 Yer ve duvar kaplama
43.33.01 Bina ve diğer yapıların içiveya dışında yer ve duvar kaplamafaaliyetleri (mermer, mozaik,granit, karo ve kaldırımtaşlarının, parke dahil ahşap yerve duvar kaplamalarının döşenmesivb.) (halı, taban muşambası vekağıt kaplama hariç) Çok Tehlikeli
43.33.02 Başka yerde sınıflandırılmamışdiğer yer döşeme ve kaplama ileduvar kaplama işleri (halı, tabanmuşambası ve diğer esnek yerkaplamaları ile duvar kaplamaişleri) Tehlikeli
43.34 Boya ve cam işleri
43.34.01 Binaların iç ve dış boyamaişleri Çok Tehlikeli
43.34.02 Cam takma işleri Çok Tehlikeli
43.34.03 Bina dışı yapıların boyamaişleri Çok Tehlikeli
43.39 İnşaatlardaki diğer bütünleyicive tamamlayıcı işler
43.39.01 Dekoratif malzemenin,bezemelerin ve süslerin montajı ileinşaatlardaki bys. diğerbütünleyici ve tamamlayıcı işler(radyatörleri kaplayan ızgaralarınmontajı ile akustik panel, karoveya diğer malzemeleri içerenakustik işler dahil) Tehlikeli
43.39.02 Yeni binaların inşaat sonrasıtemizliği Az Tehlikeli
43.9 Diğer özel inşaatfaaliyetleri
43.91 Çatı işleri
43.91.01 Çatı işleri (çatı iskeletikurulumunu içeren inşaat işleri,çatı yapımı, çatı oluğu ve olukağzı montaj işleri ile metal vediğer malzemeden çatı kaplamaişleri) (dülgerlik işleridahil) Çok Tehlikeli
43.99 Başka yerde sınıflandırılmamışdiğer özel inşaat faaliyetleri
43.99.01 Yapısal çelik bileşenlerinkurulması işleri (bina, köprü,gezer vinç veya elektrik iletimkulesi gibi diğer yapılar içinprefabrik yapısal çelikbileşenlerin kurulması vb.) Çok Tehlikeli
43.99.02 Yeraltı çalışmaları(madencilik, depolama, vb. içindüşey galeri ve kuyu açma faaliyetidahil, su kuyusu açma hariç) Çok Tehlikeli
43.99.03/td> Açık yüzme havuzlarınıninşaatı Tehlikeli
43.99.04 Vinç ve benzeri diğer inşaatekipmanlarının operatörü ilebirlikte kiralanması (özel birinşaat çeşidinde yer almayan) Az Tehlikeli
43.99.05 İnşaatlarda beton işleri (kalıpiçerisine beton dökülmesi vb.) Çok Tehlikeli
43.99.06 Duvarcılık ve tuğla örmeişleri Çok Tehlikeli
43.99.07 İnşaat iskelesi ve çalışmaplatformunu kurma ve sökmeişleri Çok Tehlikeli
43.99.08 Su yalıtım işleri (düz çatı veteraslardaki su yalıtım işleri,inşaat ve diğer yer altı yapılarındış cephesindeki su yalıtım işleri,nem yalıtımı vb.) Çok Tehlikeli
43.99.10 Baca ve sanayi fırınlarınıninşaatı ve kurulması (fırınlar içinyanma odasına ateş tuğlasıdöşenmesi işleri dahil) Çok Tehlikeli
43.99.11 İnşaat amaçlı kazık çakma vetemel inşaatı işleri (forekazıkçakma dahil) Çok Tehlikeli
43.99.12 Yapıların dış cepheleri içinbuharlı temizleme, kum püskürtme vebenzeri uzmanlaşmış inşaatfaaliyetleri Çok Tehlikeli
43.99.13 İnşaat demirciliği (inşaatdemirinin bükülmesi vebağlanması) Çok Tehlikeli
43.99.14 Prefabrik yapıların montajı vekurulması (prefabrik binalar hariçher çeşit prefabrik sokakdüzeneklerinin (otobüs durağı,telefon kulübesi, bank vb.)kurulumu vb.) Tehlikeli
43.99.15 Başka yerde sınıflandırılmamışdiğer uzmanlaşmış inşaat işleri(şömine, barbekü dahil) Tehlikeli
G TOPTAN VE PERAKENDE TİCARET;MOTORLU KARA TAŞITLARININ VEMOTOSİKLETLERİN ONARIMI
45 Motorlu kara taşıtlarının vemotosikletlerin toptan ve perakendeticareti ile onarımı
45.1 Motorlu kara taşıtlarınınticareti
45.11 Otomobillerin ve hafif motorlukara taşıtlarının ticareti
45.11.10 Otomobillerin ve hafif motorlukara taşıtlarının toptan ticareti(ambulans ve minibüs benzerimotorlu yolcu taşıtları dahil (3,5tondan daha az)) Az Tehlikeli
45.11.11 Otomobillerin ve hafif motorlukara taşıtlarının belirli bir malatahsis edilmiş mağazalardaperakende ticareti (ambulans veminibüs benzeri motorlu yolcutaşıtları dahil (3,5 tondan dahaaz)) (galericiler dahil) Az Tehlikeli
45.11.12 Otomobil ve hafif motorlu karataşıtlarının bir ücret veyasözleşmeye dayalı olarak (aracılar)toptan ticareti (ambulans veminibüs benzeri motorlu yolcutaşıtları (3,5 tondan daha az)dahil) Az Tehlikeli
45.11.13 Otomobil ve hafif motorlu karataşıtlarının diğer perakendeticareti (ambulans ve minibüsbenzeri motorlu yolcu taşıtlarıdahil (3,5 tondan daha az))(aracılar ile internet, TV. Vb.Üzerinden ticaret dahil) Az Tehlikeli
45.19 Diğer motorlu kara taşıtlarınınticareti
45.19.01 Diğer motorlu kara taşıtlarınıntoptan ticareti (kamyonlar,çekiciler, otobüsler, römorklar,yarı römorklar, karavanlar vemotorlu karavanlar) Az Tehlikeli
45.19.02 Diğer motorlu kara taşıtlarınınperakende ticareti (kamyonlar,çekiciler, otobüsler, römorklar,yarı römorklar, karavanlar vemotorlu karavanlar) Az Tehlikeli
45.2 Motorlu kara taşıtlarının bakımve onarımı
45.20 Motorlu kara taşıtlarının bakımve onarımı
45.20.01 Motorlu kara taşıtlarınınelektrik sistemlerinin onarımı Az Tehlikeli
45.20.02 Motorlu kara taşıtlarınınlastik onarımı (tekerlek ayar vebalansı dahil) Tehlikeli
45.20.03 Araba yağlama, yıkama, cilalamave benzeri faaliyetler Az Tehlikeli
45.20.04 Motorlu taşıtların koltuk vedöşemelerinin bakım ve onarımı Az Tehlikeli
45.20.05 Motorlu kara taşıtlarınınkaroser ve kaporta onarımı vb.faaliyetler (kapı, kilit, cam,boyama, çarpma onarımı vb.) Tehlikeli
45.20.06 Motorlu kara taşıtlarının genelbakım ve onarımı (radyatör, klimave egzoz bakım ve onarımı dahil,aynı işletmede yapılanlar ileelektrik sistemi, tekerlek vekaroser onarım hizmetlerihariç) Tehlikeli
45.20.07 Motorlu kara taşıtlarının genelbakım ve onarım hizmetleri (aynıişletmede mekanik, elektriksistemi, kaporta, boya, frensistemi, cam, pencere vb. bakım veonarımının yapılması) Tehlikeli
45.20.08 Motorlu kara taşıtlarına LPGsistemi montajı ve bakımıhizmetleri Tehlikeli
45.3 Motorlu kara taşıtlarının parçave aksesuarlarının ticareti
45.31 Motorlu kara taşıtlarının parçave aksesuarlarının toptanticareti
45.31.10 Motorlu kara taşıtlarınınaksesuarlarının toptan ticareti(oto alarm sistemleri dahil,motosiklet parça ve aksesuarlarıhariç) Az Tehlikeli
45.31.11 Motorlu kara taşıtlarınınparçalarının toptan ticareti(dorse, damper, akü dahil,motosiklet parça ve aksesuarlarıhariç) Az Tehlikeli
45.31.12 Motorlu kara taşıtılastiklerinin ve jantlarının toptanticareti (motosiklet ve bisikletlastiği ve jantları hariç) Az Tehlikeli
45.31.13 Motorlu kara taşıtlarınıncamlarının toptan ticareti Az Tehlikeli
45.31.14 Motorlu kara taşıtlarının parçave aksesuarlarının bir ücret ya dasözleşmeye dayalı olarak toptanticareti Az Tehlikeli
45.32 Motorlu kara taşıtlarının parçave aksesuarlarının perakendeticareti
45.32.02 Motorlu kara taşıtlarınınparçalarının belirli bir malatahsis edilmiş mağazalardaperakende ticareti (dorse, damper,akü dahil, lastik ve camlar ilemotosiklet parça ve aksesuarlarıhariç) Az Tehlikeli
45.32.03 Motorlu kara taşıtılastiklerinin ve jantlarınınbelirli bir mala tahsis edilmişmağazalarda perakende ticareti(motosiklet parça ve aksesuarlarıhariç) Az Tehlikeli
45.32.04 Motorlu kara taşıtlarınınaksesuarlarının belirli bir malatahsis edilmiş mağazalardaperakende ticareti (motosikletparça ve aksesuarları hariç) Az Tehlikeli
45.32.05 Motorlu kara taşıtı camlarınınbelirli bir mala tahsis edilmişmağazalarda perakende ticareti(motosiklet parça ve aksesuarlarıhariç) Az Tehlikeli
45.32.06 Motorlu kara taşıtlarınınikinci el (kullanılmış)parçalarının belirli bir malatahsis edilmiş mağazalardaperakende ticareti (motosikletparça ve aksesuarları hariç) Az Tehlikeli
45.32.90 Motorlu kara taşıtlarının parçave aksesuarlarının diğer perakendeticareti (uzmanlaşmamış olanlar ileinternet, posta, tezgah, pazar vb.yoluyla yapılanlar) (motosikletparça ve aksesuarları hariç) Az Tehlikeli
45.4 Motosiklet ve ilgili parça veaksesuarların ticareti, bakımı veonarımı
45.40 Motosiklet ve ilgili parça veaksesuarların ticareti, bakımı veonarımı
45.40.01 Motosiklet ve motorlubisikletlerin bakım ve onarımhizmetleri Tehlikeli
45.40.02 Motosikletler ve motorlubisikletlerin belirli bir malatahsis edilmiş mağazalardaperakende ticareti Az Tehlikeli
45.40.03 Motosikletler ve motorlubisikletlerin parça veaksesuarlarının belirli bir malatahsis edilmiş mağazalardaperakende ticareti Az Tehlikeli
45.40.04 Motosikletler ve motorlubisikletlerin toptan ticareti Az Tehlikeli
45.40.05 Motosikletler ve motorlubisikletlerin parça veaksesuarlarının toptanticareti Az Tehlikeli
45.40.06 Motosikletler, motorlubisikletler ve bunların parça veaksesuarlarının bir ücret veyasözleşmeye dayalı olarak toptanticareti Az Tehlikeli
45.40.07 Motosikletler, motorlubisikletler ve bunların parça veaksesuarlarının diğer perakendeticareti (uzmanlaşmamış olanlar ileinternet, posta, tezgah, pazar vb.yoluyla yapılanlar) Az Tehlikeli
46 Toptan ticaret (Motorlu karataşıtları ve motosikletlerhariç)
46.1 Bir ücret veya sözleşmeyedayalı olarak yapılan toptanticaret
46.11 Tarımsal hammaddelerin, canlıhayvanların, tekstilhammaddelerinin ve yarı mamulmalların satışı ile ilgiliaracılar
46.11.01 Çiçeklerin, bitkilerin, diğertarımsal hammaddelerin, tekstilhammaddelerinin ve yarı mamulmalların bir ücret veya sözleşmeyedayalı olarak toptan satışını yapanaracılar Az Tehlikeli
46.11.02 Canlı hayvanların bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.12 Yakıtların, madencevherlerinin, metallerin veendüstriyel kimyasalların satışıile ilgili aracılar
46.12.01 Katı, sıvı ve gaz haldekiyakıtların ve ilgili ürünlerin birücret veya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(motorlu taşıt yakıtlarıdahil) Az Tehlikeli
46.12.02 Endüstriyel kimyasallar,gübreler ve zirai kimyasalürünlerin bir ücret veya sözleşmeyedayalı olarak toptan satışını yapanaracılar Az Tehlikeli
46.12.03 Birincil formdaki metaller vemetal cevherlerinin bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar (inşaatdemiri dahil) Az Tehlikeli
46.13 Kereste ve inşaatmalzemelerinin satışı ile ilgiliaracılar
46.13.01 İnşaat malzemesinin bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(inşaat demiri ve kerestesihariç) Az Tehlikeli
46.13.02 Kereste ve kereste ürünlerininbir ücret veya sözleşmeye dayalıolarak toptan satışını yapanaracılar Az Tehlikeli
46.14 Makine, sanayi araç vegereçleri ile deniz ve havataşıtlarının satışı ile ilgiliaracılar
46.14.01 Bilgisayar, yazılım, elektronikve telekomünikasyon donanımlarınınve diğer büro ekipmanlarının birücret veya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.14.02 Başka yerde sınıflandırılmamıştarım, makine ve sanayiekipmanlarının bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.14.03 Gemilerin, hava taşıtlarının vebaşka yerde sınıflandırılmamışdiğer ulaşım araçlarının bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.15 Mobilya, ev eşyaları, madenieşyalar ve hırdavatların satışı ileilgili aracılar
46.15.01 Mobilyaların bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.15.02 Hırdavatçı (nalburiye)eşyalarının ve el aletlerinin birücret veya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.15.03 Radyo, televizyon ve videocihazlarının bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.15.04 Başka yerde sınıflandırılmamışçatal-bıçak takımı, diğer kesicialetler ve ev eşyalarının bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.16 Tekstil, giysi, kürk, ayakkabıve deri eşyaların satışı ile ilgiliaracılar
46.16.01 Deri giyim eşyası, kürk veayakkabının bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.16.02 Deri eşyalar ve seyahataksesuarlarının bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.16.03 Giyim eşyalarının bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(deri giyim eşyaları hariç) Az Tehlikeli
46.16.04 Tekstil ürünlerinin bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(iplik, kumaş, ev tekstili, perdevb. ürünler) (giyim eşyalarıhariç) Az Tehlikeli
46.17 Gıda, içecek ve tütün satışıile ilgili aracılar
46.17.01 Gıda maddelerinin bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(aracı üretici birlikleri dahil,yaş sebze ve meyve hariç) Az Tehlikeli
46.17.02 Yaş sebze ve meyvelerin birücret ve sözleşmeye dayalı olaraktoptan satışını yapan aracılar(kabzımallık ve aracı üreticibirlikleri dahil) Az Tehlikeli
46.17.03 Tütün ve tütün ürünlerinin birücret veya sözleşmeye dayalı olaraktoptan satışını yapan aracılar(aracı üretici birlikleridahil) Az Tehlikeli
46.17.04 İçeceklerin bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.18 Belirli diğer ürünlerin satışıile ilgili uzmanlaşmışaracılar
46.18.01 Oyun ve oyuncak, spormalzemesi, bisiklet, kitap, gazete,dergi, kırtasiye ürünleri, müzikaleti, saat ve mücevher ilefotoğrafçılıkla ilgili ve optikaletlerin bir ücret veya sözleşmeyedayalı olarak toptan satışını yapanaracılar Az Tehlikeli
46.18.02 Kozmetik, parfüm ve bakımürünleri ile temizlik malzemesininbir ücret veya sözleşmeye dayalıolarak toptan satışını yapanaracılar Az Tehlikeli
46.18.03 Tıbbi ürünlerin, araç vemalzemelerin bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.18.04 Kağıt ve karton (mukavva) ileilgili belirli ürünlerin bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.18.05 Eczacılıkla ilgili ürünlerinbir ücret veya sözleşmeye dayalıolarak toptan satışını yapanaracılar Az Tehlikeli
46.18.06 İşlenmemiş ağaç, atık, hurda vegeri dönüştürülebilir malzemeler,vb. başka yerde sınıflandırılmamışdiğer belirli ürünlerin bir ücretveya sözleşmeye dayalı olaraktoptan satışını yapan aracılar Az Tehlikeli
46.19 Çeşitli malların satışı ileilgili aracılar
46.19.01 Çeşitli malların bir ücret veyasözleşmeye dayalı olarak toptansatışını yapan aracılar Az Tehlikeli
46.19.02 Çeşitli malların müzayede,mezat, açık arttırma yoluyla toptansatışını yapan aracılar Az Tehlikeli
46.2 Tarımsal hammadde ve canlıhayvanların toptan ticareti
46.21 Tahıl, işlenmemiş tütün, tohumve hayvan yemi toptan ticareti
46.21.01 Hayvan yemi toptan ticareti(kuş yemi, yemlik kökleri, yemlikkıvırcık lahana, darı, kaplıca,yonca, yemlik mısır vb. ile kepek,kırma, küspe, vb.) Az Tehlikeli
46.21.02 Tahıl toptan ticareti (buğday,arpa, çavdar, yulaf, mısır, çeltikvb.) Az Tehlikeli
46.21.03 Yağlı tohum ve yağlı meyvelerintoptan ticareti (soya fasulyesi,yer fıstığı, pamuk çekirdeği, ketentohumu, kolza, ayçiçeği tohumu,pamuk çekirdeği vb.) Az Tehlikeli
46.21.04 İşlenmemiş tütün toptanticareti Az Tehlikeli
46.21.05 İpek böceği kozası toptanticareti Az Tehlikeli
46.21.06 Pamuk toptan ticareti Tehlikeli
46.21.07 Yün ve tiftik toptanticareti Az Tehlikeli
46.21.08 Tohum (yağlı tohumlar hariç)toptan ticareti (sebze tohumları,çiçek tohumları ve orman ağacıtohumları dahil) Az Tehlikeli
46.21.90 Başka yerde sınıflandırılmamışdiğer tarımsal ham maddelerintoptan ticareti (işlenmemişyenilemeyen sakatatlar, kuştüyü vederileri, laka, kına çiçeği, doğalsüngerler, doğal mantar (yenilenlerhariç), karabiber, doğal kauçukvb.) Az Tehlikeli
46.22 Çiçeklerin ve bitkilerin toptanticareti
46.22.01 Çiçek, bitki ve çiçek soğanıtoptan ticareti Az Tehlikeli
46.23 Canlı hayvanların toptanticareti
46.23.01 Canlı hayvanların toptanticareti (celepçilik) (kümeshayvanları hariç) Tehlikeli
46.23.02 Canlı kümes hayvanları (tavuk,hindi, vb.) toptan ticareti Tehlikeli
46.24 Ham deri, post ve deri toptanticareti
46.24.01 Ham deri, post ve kürklü deritoptan ticareti Az Tehlikeli
46.24.02 Tabaklanmış deri, güderi vekösele toptan ticareti Az Tehlikeli
46.3 Gıda, içecek ve tütün toptanticareti
46.31 Meyve ve sebzelerin toptanticareti
46.31.01 Fındık, antep fıstığı, yerfıstığı ve ceviz toptan ticareti(kavrulmuş olanlar hariç) Az Tehlikeli
46.31.02 Taze incir ve üzüm toptanticareti Az Tehlikeli
46.31.03 Narenciye toptan ticareti Az Tehlikeli
46.31.04 Diğer taze meyve sebze toptanticareti (patates dahil) Az Tehlikeli
46.31.05 Zeytin (işlenmiş) toptanticareti Az Tehlikeli
46.31.06 Kültür mantarı toptanticareti Az Tehlikeli
46.31.08 Kuru bakliyat ürünleri toptanticareti (fasulye, mercimek, nohut,vb.) Az Tehlikeli
46.31.09 Kavrulmuş veya işlenmişkuruyemiş toptan ticareti (leblebi,kavrulmuş fındık, fıstık, çekirdekvb.) Az Tehlikeli
46.31.10 Kuru üzüm toptan ticareti Az Tehlikeli
46.31.11 Kuru incir toptan ticareti Az Tehlikeli
46.31.12 Kuru kayısı toptanticareti Az Tehlikeli
46.31.90 Diğer işlenmiş veya korunmuşsebze ve meyve toptan ticareti(reçel, pekmez, pestil, salamuraveya turşusu yapılmış olanlardahil) (fındık, incir, üzüm,narenciye, zeytin, kültür mantarıve kuruyemiş hariç) Az Tehlikeli
46.32 Et ve et ürünlerinin toptanticareti
46.32.01 Kümes hayvanları ve avhayvanları etlerinin toptanticareti Tehlikeli
46.32.02 Et toptan ticareti (avhayvanları ve kümes hayvanlarıetleri hariç) Tehlikeli
46.32.03 Yenilebilir sakatat (ciğer,işkembe, böbrek, taşlık vb.) toptanticareti Tehlikeli
46.32.04 Et ürünlerinin toptan ticareti(salam, sosis, sucuk, pastırmavb.) Tehlikeli
46.33 Süt ürünleri, yumurta veyenilebilir sıvı ve katı yağlarıntoptan ticareti
46.33.01 Süt ürünleri toptan ticareti(işlenmiş süt, süt tozu, yoğurt,peynir, kaymak, tereyağ vb.) Tehlikeli
46.33.02 Yumurta ve yumurta ürünleritoptan ticareti Az Tehlikeli
46.33.03 Hayvan veya bitkisel kaynaklıyenilebilir sıvı ve katı yağlarıntoptan ticareti (tereyağhariç) Az Tehlikeli
46.34 İçecek toptan ticareti
46.34.01 Alkollü içeceklerin toptanticareti Az Tehlikeli
46.34.02 Meyve ve sebze suları, madensuyu, meşrubat ve diğer alkolsüziçeceklerin toptan ticareti (suhariç) Az Tehlikeli
46.34.03 Su toptan ticareti (suistasyonları dahil, şebeke suyuhariç) Az Tehlikeli
46.35 Tütün ürünlerinin toptanticareti
46.35.01 Tütün ürünlerinin toptanticareti (pipo tütünü, sigara, purovb.) (işlenmemiş tütün hariç) Az Tehlikeli
46.36 Şeker, çikolata ve şekerlemetoptan ticareti
46.36.01 Çikolata ve şekerleme toptanticareti (helva, lokum, akideşekeri, bonbon şekeri vb.dahil) Az Tehlikeli
46.36.02 Fırıncılık mamullerinin toptanticareti Az Tehlikeli
46.36.03 Şeker toptan ticareti (tozşeker, kesme şeker, kristal şekervb.) Az Tehlikeli
46.36.04 Dondurma ve diğer yenilebilirbuzların toptan satışı Az Tehlikeli
46.37 Kahve, çay, kakao ve baharattoptan ticareti
46.37.01 Çay toptan ticareti Az Tehlikeli
46.37.02 Kahve, kakao ve baharat toptanticareti Az Tehlikeli
46.37.03 İçecek amaçlı kullanılanaromatik bitkilerin toptanticareti Az Tehlikeli
46.38 Balık, kabuklular veyumuşakçalar da dahil diğer gıdamaddelerinin toptan ticareti
46.38.01 Balık, kabuklular, yumuşakçalarve diğer su ürünleri toptanticareti Tehlikeli
46.38.02 Ev hayvanları için yemlerinveya yiyeceklerin toptan ticareti(çiftlik hayvanları için olanlarhariç) Az Tehlikeli
46.38.03 Gıda tuzu (sofra tuzu) toptanticareti Az Tehlikeli
46.38.04 Un, nişasta, makarna, şehriyevb. ürünler ile hazır gıdaların(et/sebze suları, hazır çorbalarvb.) toptan ticareti (ekmek mayası,kuru maya vb. dahil) Az Tehlikeli
46.38.05 Hazır homojenize gıda ilediyetetik gıda ürünleri toptanticareti (bebek maması, diyetgıdaları, sporcu gıdaları vb.) Az Tehlikeli
46.38.06 Başka yerde sınıflandırılmamışdiğer gıda ürünlerinin toptanticareti (doğal bal, malt, hazıryemek, sirke vb.) Az Tehlikeli
46.39 Belirli bir mala tahsisedilmemiş mağazalardaki gıda,içecek ve tütün toptanticareti
46.39.01 Belli bir mala tahsis edilmemişmağazalarda dondurulmuş gıda toptanticareti Az Tehlikeli
46.39.02 Belli bir mala tahsis edilmemişmağazalarda gıda (dondurulmamış),içecek ve tütün toptanticareti Az Tehlikeli
46.4 Ev eşyalarının toptanticareti
46.41 Tekstil ürünlerinin toptanticareti
46.41.01 Evde kullanılan tekstiltakımları, perdeler ve çeşitlitekstil malzemesinden ev eşyalarıtoptan ticareti (çarşaf, yataktakımı, yastık kılıfı, masa örtüsü,havlu, battaniye, yorgan, diğermefruşatlar vb. dahil) Az Tehlikeli
46.41.02 Tuhafiye ürünleri toptanticareti (iğne, dikiş ipliği,düğme, fermuar, çıtçıt, fisto,dantel, gipür vb.) Az Tehlikeli
46.41.03 Kumaş toptan ticareti(manifatura ürünleri dahil) Az Tehlikeli
46.41.04 İplik toptan ticareti (tuhafiyeürünleri ile dikiş ipliğihariç) Az Tehlikeli
46.41.05 Diğer tekstil ürünleri toptanticareti (balık ağı, çuval, çul,halat, urgan dahil) Az Tehlikeli
46.42 Giysi ve ayakkabı toptanticareti
46.42.01 Bebek giysileri, sporcugiysileri ve diğer giyimeşyalarının toptan ticareti (kayakkıyafetleri, yüzme kıyafetleri,mayo vb. dahil) Az Tehlikeli
46.42.02 Ayakkabı toptan ticareti(terlik, çarık, mes, vb. dahil,spor ayakkabıları hariç) Az Tehlikeli
46.42.03 Çorap ve giysi aksesuarlarınıntoptan ticareti (şapka, eldiven,şal, papyon, kravat vb.) Az Tehlikeli
46.42.04 Kürk ve deriden giyimeşyalarının toptan ticareti Az Tehlikeli
46.42.05 Dış giyim eşyalarının toptanticareti (iş giysileri ile trikoolanlar dahil, kürk ve deridenolanlar hariç) Az Tehlikeli
46.42.06 İç giyim eşyalarının toptanticareti (slip, külot, gömlek,tişört, sabahlık, pijama, sütyen,korse, bornoz, vb.) Az Tehlikeli
46.42.07 Şemsiye toptan ticareti (güneşve bahçe şemsiyeleri hariç) Az Tehlikeli
46.42.08 Ayakkabı malzemeleri toptanticareti Az Tehlikeli
46.43 Elektrikli ev aletleri toptanticareti
46.43.01 Beyaz eşya toptan ticareti(buzdolabı, çamaşır makinesi,bulaşık makinesi, fırın, çamaşırkurutma makinesi vb.) Az Tehlikeli
46.43.04 Plak, ses ve görüntü kasetleri,CD ve DVD toptan ticareti (boşolanlar hariç) Az Tehlikeli
46.43.05 Elektrik malzemeleri toptanticareti (kablo, sigorta, duy, fiş,priz, ampul, elektrik anahtarı,devre kesici, şalter, röle, pil,batarya, vb.) (endüstriyel olanlarile elektrikli makine, cihaz vealetlerde kullanılanlar hariç) Az Tehlikeli
46.43.08 Hırsız ve yangın alarmları ilebenzeri cihazların toptan ticareti- evlerde kullanım amaçlı Az Tehlikeli
46.43.09 Radyo, televizyon, video ve DVDcihazlarının toptan ticareti(antenler ile arabalar için radyove TV ekipmanları dahil) Az Tehlikeli
46.43.10 Fotoğrafçılıkla ilgiliürünlerin toptan ticareti (flaşlambaları, fotoğrafçılıkemülsiyonları, polarizan maddeler,fotografik levha ve filmlervb.) Az Tehlikeli
46.43.11 Optik ürünlerin toptan ticareti(gözlükler, saat ve gözlük camları,dürbün, vb.) Az Tehlikeli
46.43.12 Konutlarda, bürolarda vemağazalarda kullanılan (sanayi tipiolmayan) klimaların toptanticareti Az Tehlikeli
46.43.90 Başka yerde sınıflandırılmamışelektrikli ev aletleri toptanticareti (ütü, elektrik süpürgesi,aspiratör, vantilatör,tıraşmakinesi, saç kurutma makinesi, suarıtma cihazı, dikiş makinesi,şofben, elektrikli soba, elektrikliradyatör vb.) Az Tehlikeli
46.44 Porselen ve cam eşya iletemizlik maddelerinin toptanticareti
46.44.01 Porselen ve cam eşyalar iletoprak ve seramikten yapılanürünlerin toptan ticareti (çini,billuriye, cam veya porselendençanak, tabak, bardak, vazo, tepsi,süs eşyası, vb.) Az Tehlikeli
46.44.02 Temizlik malzemesi toptanticareti (deterjan, ovma krem vetozları, yumuşatıcılar, Arapsabunu, vb. dahil, kişisel temizliksabunları hariç) Az Tehlikeli
46.44.04 Cila ve krem (ayakkabı,mobilya, yer döşemesi, kaporta, camveya metal için) toptanticareti Az Tehlikeli
46.45 Parfüm ve kozmetik ürünlerinintoptan ticareti
46.45.01 Parfüm, kozmetik ürünleri vekolonya toptan ticareti (ıtriyatdahil) Az Tehlikeli
46.45.02 Sabun toptan ticareti (kişiseltemizlik için) Az Tehlikeli
46.46 Eczacılık ürünlerinin toptanticareti
46.46.01 Cerrahi, tıbbi ve ortopedikalet ve cihazların toptanticareti Az Tehlikeli
46.46.02 Temel eczacılık ürünleri ileeczacılık müstahzarlarının toptanticareti Az Tehlikeli
46.46.03 Dişçilikte kullanılan alet vecihazların toptan ticareti(protezler, bağlantı parçalarıdahil) Az Tehlikeli
46.46.04 Hayvan sağlığı ile ilgiliilaçların toptan ticareti (serum,aşı, vb.) Az Tehlikeli
46.47 Mobilya, halı ve aydınlatmaekipmanlarının toptan ticareti
46.47.01 Mobilya ve mobilya aksesuarlarıtoptan ticareti (yatak dahil) Az Tehlikeli
46.47.02 Halı, kilim, vb. yerkaplamaları toptan ticareti Az Tehlikeli
46.47.03 Aydınlatma ekipmanlarınıntoptan ticareti (avize, abajur,vb.) Az Tehlikeli
46.48 Saat ve mücevher toptanticareti
46.48.01 Mücevher ve takı toptanticareti (altın, gümüş, vb.olanlar) (imitasyon olanlarhariç) Az Tehlikeli
46.48.02 Saat toptan ticareti (kol,masa, duvar, vb. saatler ilekronometreler) Az Tehlikeli
46.49 Diğer ev eşyalarının toptanticareti
46.49.01 Deri eşyalar ve seyahataksesuarları toptan ticareti(çanta, valiz, cüzdan, kemer, vb.dahil) Az Tehlikeli
46.49.02 Spor malzemesi toptan ticareti(basketbol, futbol, vb. sporayakkabıları, kayak botları gibiözel spor ayakkabıları, bisikletlerve bisiklet parçaları ileaksesuarları, çadır ve kampmalzemeleri dahil) Az Tehlikeli
46.49.03 Kırtasiye ürünleri toptanticareti Az Tehlikeli
46.49.04 Oyun ve oyuncak toptan ticareti(yap-bozlar, oyun kağıtları,jetonla çalışan oyun makineleri vb.dahil) Az Tehlikeli
46.49.05 Hasır eşyalar, mantar eşyalarve diğer ahşap ürünlerin toptanticareti (ip vb. için makaralardahil) Az Tehlikeli
46.49.06 Müzik aletleri toptanticareti Az Tehlikeli
46.49.07 Çatal-bıçak takımı ve diğerkesici aletler ile metal sofra vemutfak eşyalarının toptan ticareti(bakır mutfak eşyaları dahil) Az Tehlikeli
46.49.08 Tuvalet kağıdı, peçete, kağıthavlu ile kağıt tepsi, tabak,bardak, çocuk bezi vb. toptanticareti (plastikten olanlarhariç) Az Tehlikeli
46.49.09 Sportif amaçlı avcılık vebalıkçılık malzemeleri toptanticareti (tabanca, av tüfeği vebalık ağları hariç) Az Tehlikeli
46.49.11 Kitap, dergi ve gazete toptanticareti Az Tehlikeli
46.49.12 Hediyelik eşya toptan ticareti(pipo, tespih, bakır süs eşyaları,imitasyon takılar dahil) Az Tehlikeli
46.49.16 Kişisel veya ev tipi tartıaletleri ve basküllerin toptanticareti Az Tehlikeli
46.49.17 Plastik sofra, mutfak ve diğerev eşyası ile tuvalet eşyası toptanticareti (plastik tepsi, bardak,tabak, poşet, sünger vb.) Az Tehlikeli
46.49.21 Sanat eserleri toptan ticareti(büst ve heykeller dahil) Az Tehlikeli
46.49.22 Tıraş bıçakları, usturalar vejiletlerin toptan ticareti Az Tehlikeli
46.49.23 Sanatsal reprodüksiyonürünlerinin toptan ticareti (resim,fotoğraf vb.) Az Tehlikeli
46.49.24 Resim, fotoğraf vb. içinçerçeve toptan ticareti Az Tehlikeli
46.49.25 Arı kovanı toptan ticareti Az Tehlikeli
46.49.26 Spor ve eğlence amaçlıteknelerin, kayıkların ve kanolarıntoptan ticareti (deniz taşıtlarıiçin dıştan takmalı motorlardahil) Az Tehlikeli
46.49.27 Pul ve jeton toptanticareti Az Tehlikeli
46.49.90 Başka yerde sınıflandırılmamışev eşyaları ve ev gereçlerinintoptan ticareti (güneş ve bahçeşemsiyesi, çakmak, kibrit, süpürgefırçası, diş fırçası, saç fırçası,yapma çiçek, mum, bebek arabası,şişme yatak, elektriksiz soba,kuzine, gaz ocağı vb.) Az Tehlikeli
46.5 Bilgi ve iletişim teknolojisiekipmanlarının toptan ticareti
46.51 Bilgisayar, bilgisayar çevrebirimleri ve yazılım toptanticareti
46.51.01 Bilgisayar, bilgisayar çevrebirimleri ve yazılımlarının toptanticareti (bilgisayar donanımları,pos cihazları, ATM cihazları vb.dahil) Az Tehlikeli
46.52 Elektronik ve telekomünikasyonekipmanlarının ve parçalarınıntoptan ticareti
46.52.01 Telekomünikasyon ekipman veparçalarının toptan ticareti(telefon ve iletişim ekipmanlarıdahil) Az Tehlikeli
46.52.02 Elektronik cihaz veparçalarının toptan ticareti(elektronik valfler, tüpler, yarıiletken cihazlar, mikroçipler,entegre devreler, baskılı devreler,vb.) (seyrüsefer cihazlarıhariç) Az Tehlikeli
46.52.04 Boş ses ve görüntü kaset vedisketleri ile manyetik ve optikdisk, CD ve DVD toptanticareti Az Tehlikeli
46.52.05 Yön bulma pusulaları ve diğerseyrüsefer alet ve cihazlarınıntoptan ticareti Az Tehlikeli
46.6 Diğer makine, ekipman, aksam veparçaları ile büro mobilyalarınıntoptan ticareti
46.61 Tarımsal amaçlı makine veekipmanlar ile aksam veparçalarının toptan ticareti
46.61.02 Tarım, hayvancılık veormancılık makine ve ekipmanlarıile aksam ve parçalarının toptanticareti (traktör, tarımsal römork,pulluk, gübre yayma makinesi,mibzer, biçer döver, süt sağmamakinesi, kümes hayvanlarımakineleri, arıcılık makineleri,vb.) Az Tehlikeli
46.61.03 Çim biçme ve bahçe makine veekipmanları ile aksam veparçalarının toptan ticareti Az Tehlikeli
46.62 Takım tezgahlarının toptanticareti
46.62.01 Ağaç işleme takım tezgahları veparçalarının toptan ticareti (parçatutucuları dahil) Az Tehlikeli
46.62.02 Metal işleme takımtezgahlarının ve parçalarınıntoptan ticareti (parça tutucularıdahil) Az Tehlikeli
46.62.04 Lehimleme veya kaynak yapmaiçin kullanılan makineler ilemetallerin veya sinterlenmiş metalkarbürlerin sıcak spreylenmesi içinkullanılan elektrikli makine vecihazlar ile parçalarının toptanticareti Az Tehlikeli
46.62.90 Diğer malzemeleri işleme içintakım tezgahları ve parçalarınıntoptan ticareti (parça tutucularıdahil) (ağaç ve metal işlemedekullanılanlar hariç) Az Tehlikeli
46.63 Madencilik, bina ve bina dışıinşaat makinelerinin toptanticareti
46.63.01 Bina ve bina dışı inşaat işmakinelerinin toptan ticareti(inşaat pompaları, dozer, greyder,kepçe vb. dahil) Az Tehlikeli
46.63.02 Madencilik makinelerinin toptanticareti (madenler içinbocurgatlar, sürekli hareketlielavatörler ve konveyörlerdahil) Az Tehlikeli
46.64 Tekstil endüstrisi makineleriile dikiş ve örgü makinelerinintoptan ticareti
46.64.01 Tekstil endüstrisi makineleriile dikiş ve örgü makinelerinintoptan ticareti (ev tipi olanlarhariç) Az Tehlikeli
46.64.02 Tekstil endüstrisimakinelerinin, dikiş ve örgümakinelerininin parça veaksesuarlarının toptan ticareti (evtipi olanlara ait parça veaksesuarlar hariç) Az Tehlikeli
46.65 Büro mobilyalarının toptanticareti
46.65.01 Büro mobilyalarının toptanticareti Az Tehlikeli
46.66 Diğer büro makine veekipmanlarının toptan ticareti
46.66.01 Diğer büro makine veekipmanlarının toptan ticareti(bilgisayar ve bilgisayar çevredonanımları hariç) (hesap makinesi,daktilo, yazarkasa, fotokopimakinesi, stenografi makinesi,kalemtıraş, büro tipi zımba, delgialeti vb.) Az Tehlikeli
46.69 Diğer makine ve ekipmanlarıntoptan ticareti
46.69.01 Ulaşım araçları toptan ticareti(gemi, römorkör, lokomotif, havataşıtları vb. ile bunlarınparçaları ve konteynerler dahil,motorlu kara taşıtları, motosikletve bisikletler hariç) Az Tehlikeli
46.69.03 Akümülatör, batarya, pil vebuların parçalarının toptanticareti (evlerde, motosikletlerdeve motorlu kara taşıtlarındakullanılanlar hariç) Az Tehlikeli
46.69.04 Kompresör ve parçalarınıntoptan ticareti (soğutma, hava vediğer amaçlar için) Az Tehlikeli
46.69.05 Silah ve mühimmat toptanticareti (tabanca, av tüfeği vb.dahil) Tehlikeli
46.69.06 Makine ve ekipmanlarla ilgiliaksam ve parçaların toptan ticareti(değirmentaşı, bileği taşı, zımparave aşındırma ürünleri, konveyörbantları, teknik kullanım için camve seramik ürünler, rulmanlar, vb.)(motorlu kara taşıtları içinolanlar hariç) Az Tehlikeli
46.69.07 Kaldırma ve taşımaekipmanlarının toptan ticareti(forkliftler, araç liftleri,asansörler, yürüyen merdivenler,konveyörler, vinçler, vb.) Az Tehlikeli
46.69.08 Gıda, içecek ve tütünsanayisinde kullanılan makinelerile parçalarının toptan ticareti(şişe vb. kapları temizleme vedoldurma makineleri, süt ürünlerimakineleri, içecek ve tütün işlememakineleri, tarımsal ürünkurutucuları vb.) Az Tehlikeli
46.69.09 Rüzgar türbinleri,kondansatörler, elektrikyalıtkanları (izolatör), AC/AD/DCmotorlar, jeneratörler, yalıtılmışbobin telleri vb. elektriklimakine, cihaz ve aletlerin toptanticareti Az Tehlikeli
46.69.10 Hırsız ve yangın alarmları ilesinyalizasyon ve trafik kontrolekipmanları toptan ticareti (ev vearabalar için olanlar hariç) Az Tehlikeli
46.69.11 Gaz, sıvı veya elektrik teminveya üretim sayaçları toptanticareti Az Tehlikeli
46.69.12 Su buharı, hidrolik ve gaztürbinlerinin toptan ticareti Az Tehlikeli
46.69.13 Baskül, kantar ve diğer tartıve ölçüm makineleri toptan ticareti(ev tipi olanlar hariç) Az Tehlikeli
46.69.14 X ışınının veya alfa, beta yada gama ışınlarının kullanımınadayalı cihazların toptanticareti Az Tehlikeli
46.69.15 Buhar üretim kazanları vekızgın su kazanlarının toptanticareti Az Tehlikeli
46.69.16 Zırhlı veya güçlendirilmişkasalar ve kutular ile kasadaireleri için zırhlı veyagüçlendirilmiş kapılar ve kilitlikutular ile para veya evrakkutuları, vb. (adi metalden) toptanticareti Az Tehlikeli
46.69.17 Yangın söndürücüler, püskürtmetabancaları, buhar veya kumpüskürtme makineleri ile benzerimekanik cihazların toptan ticareti(tarımsal amaçlı kullanılanlar iletaşıtlar için yangın söndürücülerhariç) Az Tehlikeli
46.69.90 Genel ve özel amaçlı diğermakine, cihaz ve aletlerin toptanticareti (metal döküm içinkalıplar, demir veya çeliktentanklar, variller, fıçılar, kutularile tıpalar, şişe kapakları, vb.dahil) Az Tehlikeli
46.7 Belirli bir mala tahsis edilmişmağazalardaki diğer toptanticaret
46.71 Katı, sıvı ve gazlı yakıtlarile bunlarla ilgili ürünlerintoptan ticareti
46.71.01 Sıvı yakıtlar ve bunlarlailgili ürünlerin toptan ticareti(ham petrol, ham yağ, mazot,benzin, biodizel, fuel oil, gazyağı, madeni yağlar, gres yağlarıvb.) Çok Tehlikeli
46.71.02 Katı yakıtlar ve bunlarlailgili ürünlerin toptan ticareti(linyit, taş kömürü, odun kömürü,kok kömürü, yakacak odun vb.) Çok Tehlikeli
46.71.03 Gazlı yakıtlar ve bunlarlailgili ürünlerin toptan ticareti(LPG (bütan ve propan), tüpgaz,doğalgaz (LNG, CNG) vb. dahil,şebeke üzerinden yapılanlarhariç) Çok Tehlikeli
46.72 Metallerin ve metalcevherlerinin toptan ticareti
46.72.01 Demir dışı metal cevherleri vekonsantrelerinin toptan ticareti(alüminyum, bakır, nikel, kurşun,çinko, kalay, vb. cevherleri dahil,uranyum ve toryum cevherleri iledeğerli metal cevherlerihariç) Tehlikeli
46.72.02 Birincil formdaki demir dışımetallerin toptan ticareti – kütük,blok, granül, toz, pelet, levha,bar, çubuk, profil vb. formlarda(alüminyum, bakır, nikel, kurşun,çinko, kalay, vb. dahil, altın,gümüş ve platin hariç) Tehlikeli
46.72.03 Değerli metal cevherleri vekonsantrelerinin toptan ticareti(altın, gümüş, platin vb.) Az Tehlikeli
46.72.04 Demir cevherleri toptanticareti Tehlikeli
46.72.05 Birincil formdaki demir veçelik toptan ticareti – kütük(ingot), blok, granül, toz, pelet,parça vb. formlarda (pik demir,manganezli dökme demir, demir,çelik ve çelik alaşımları vb.) Tehlikeli
46.72.06 Birincil formdaki değerlimetallerin toptan ticareti – kütük,blok, granül, toz, pelet, levha,bar, çubuk, profil vb. formlarda(altın, gümüş, platin vb.) Tehlikeli
46.72.07 Uranyum ve toryum cevherleritoptan ticareti Çok Tehlikeli
46.72.08 Demir/çeliktenhaddelenmiş/soğuk çekilmiş yassıürünlerin toptan ticareti Tehlikeli
46.72.09 Demir/çelikten bar veçubukların, profillerin, levhakazıkların (palplanş), tüp veboruların toptan ticareti(filmaşin, inşaat demiri, sondajborusu, petrol, gaz vb. hatlar içinborular, vb. ile tel dahil) Tehlikeli
46.72.10 Demir/çelikten diğer birincilformdaki ürünlerin toptan ticareti(nervürlü levhalar, sandviçpaneller ve demir yolu veya tramvayyolu yapım malzemesi dahil) Tehlikeli
46.73 Ağaç, inşaat malzemesi ve sıhhiteçhizat toptan ticareti
46.73.01 Ağacın ilk işlenmesinden eldeedilen ürünlerin toptan ticareti(kereste, ağaç yünü, talaş veyongası, demir yolu ve tramvaytraversleri, kontrplak, yonga velifli levhalar (mdf, sunta vb.),parke panel, ahşap varil, fıçı vediğer muhafazalar, vb.) Tehlikeli
46.73.02 Boya, vernik ve lak toptanticareti Tehlikeli
46.73.03 Düz cam toptan ticareti(pencere camı, cam ayna, emniyetcamı, temperli düz cam, çok katlıyalıtım camları, camdan döşemeblokları, tuğlalar vb.) Az Tehlikeli
46.73.05 Banyo küvetleri, lavabolar,eviyeler, klozet kapakları, tuvalettaşı ve rezervuarları ileseramikten karo ve fayans vb. sıhhiürünlerin toptan ticareti (seramik,cam, mermer, plastik, mermerit,demir, çelik, bakır veya alüminyumvb.) Az Tehlikeli
46.73.06 Metalden prefabrik yapıların,köprülerin, köprü parçalarının,kulelerin, kafes direklerin,konstrüksiyon elemanlarının, diğeryapıların ve yapı elemanlarınıntoptan ticareti Tehlikeli
46.73.07 Çimento, alçı, harç, kireç,mozaik vb. inşaat malzemeleritoptan ticareti Az Tehlikeli
46.73.08 Tuğla, kiremit, briket,kaldırım taşı vb. inşaatmalzemeleri toptan ticareti Az Tehlikeli
46.73.09 Taş, kum, çakıl, mıcır, kil,kaolin vb. inşaat malzemeleritoptan ticareti Az Tehlikeli
46.73.10 İşlenmiş mermer, traverten,kaymaktaşı (su mermeri) vebunlardan yapılmış ürünlerin toptanticareti (levha halinde olanlar ilelavabo vb. sıhhi ürünlerdahil) Az Tehlikeli
46.73.11 Mermer, granit, kayağan taşı,kum taşı vb. toptan ticareti(işlenmemiş veya blok haldeolanlar) Tehlikeli
46.73.12 İşlenmemiş ağaç (tomruk-hamhaldeki) toptan ticareti (ormanağaçları, endüstriyel odunlarvb.) Tehlikeli
46.73.13 Metalden kapı, pencere vebunların kasaları ile kapıeşiklerinin toptan ticareti Az Tehlikeli
46.73.14 Ahşap kapı, pencere ve bunlarınkasaları ile kapı eşiklerinintoptan ticareti Az Tehlikeli
46.73.15 Plastik kapı, pencere vebunların kasaları ile kapıeşikleri, panjurlar, jaluziler,storlar ve benzeri eşyaların toptanticareti Az Tehlikeli
46.73.16 Betondan, çimentodan ve sunitaştan prefabrik yapıların, yapıelemanlarının ve diğer ürünlerintoptan ticareti Tehlikeli
46.73.17 Plastikten prefabrik yapılar veyapı elemanlarının toptanticareti Tehlikeli
46.73.18 Ahşaptan prefabrik yapıların veyapı elemanlarının toptanticareti Tehlikeli
46.73.19 Alçı ve alçı esaslıbileşenlerden inşaat amaçlıürünlerin toptan ticareti(kartonpiyer, panel, levhavb.) Tehlikeli
46.73.20 Plastikten inşaat amaçlıtabakalar, levhalar, filmler,folyolar, şeritler ve borular ileasfalt vb. malzemeden çatı kaplamaürünlerinin toptan ticareti(inşaat, sera vb. için naylon örtü,shingle, mantolama amaçlı strafor,vb. dahil) Az Tehlikeli
46.73.21 Duvar kağıdı, tekstil duvarkaplamaları, plastikten zemin,duvar veya tavan kaplamalarınıntoptan ticareti (paspas, kauçukpaspas, yer muşambası, marley vb.yer kaplamaları dahil) Az Tehlikeli
46.73.22 İnşaatlarda izolasyon amaçlıkullanılan malzemelerin toptanticareti (rulolar halinde cam yünü,taş yünü, bitüm esaslı malzemeler,vb.) Az Tehlikeli
46.73.23 Masif, lamine ve laminant parketoptan ticareti Az Tehlikeli
46.73.90 Başka yerde sınıflandırılmamışdiğer inşaat malzemesi toptanticareti (merdiven, korkuluk,plastik depolar, seramik borularvb. dahil) Tehlikeli
46.74 Hırdavat, sıhhi tesisat veısıtma tesisatı malzemelerinintoptan ticareti
46.74.01 Hırdavat (nalburiye) malzemesive el aletleri toptan ticareti(çivi, raptiye, vida, adi metaldenkilit, menteşe, bağlantı parçası,çekiç, testere, pense, tornavida,takım tezgahı uçları, çengel,halka, perçin, vb.) Az Tehlikeli
46.74.03 Sıhhi tesisat ve ısıtmatesisatı malzemesi toptan ticareti(lavabo musluğu, vana, valf, tıkaç,t-parçaları, bağlantılar, vb.)(kombiler ve radyatörlerhariç) Az Tehlikeli
46.74.04 Demirden veya çelikten merkeziısıtma radyatörleri, merkezi ısıtmakazanları (kombiler dahil) ilebunların parçalarının toptanticareti (buhar jeneratörleri vekızgın su üreten kazanlarhariç) Az Tehlikeli
46.74.05 Demir veya çelikten dikenlitel, bakır veya alüminyumdan örgülütel, kablo, örme şerit vebenzerleri (elektrik yalıtımıolanlar hariç), demir, çelik veyabakır tellerden mensucat, ızgara,ağ, kafeslik ve çit toptanticareti Az Tehlikeli
46.74.06 Metal rezervuar, tank, fıçı vebenzeri konteyner toptan ticareti,kapasitesi > 300 litre olanlar(merkezi ısıtma amaçlı olanlar ilemekanik veya termal ekipmanlıolanlar hariç) Az Tehlikeli
46.74.07 Tarım ve ormancılık alet vemalzemeleri toptan ticareti (balta,kazma, orak, tırpan, vb. dahil,tarımsal amaçlı makine veekipmanlar hariç) Az Tehlikeli
46.75 Kimyasal ürünlerin toptanticareti
46.75.01 Endüstriyel kimyasallarıntoptan ticareti (anilin, matbaamürekkebi, kimyasal yapıştırıcı,havai fişek, boyama maddeleri,sentetik reçine, metil alkol,parafin, esans ve tatlandırıcı,soda, sanayi tuzu, parafin, nitrikasit, amonyak, sanayi gazlarıvb.) Çok Tehlikeli
46.75.02 Suni gübrelerin toptan ticareti(gübre mineralleri, gübre ve azotbileşikleri ve turba ile amonyumsülfat, amonyum nitrat, sodyumnitrat, potasyum nitrat vb. dahil,nitrik asit, sülfonitrik asit veamonyak hariç) Az Tehlikeli
46.75.03 Hayvansal veya bitkiselgübrelerin toptan ticareti (kapalıalanda yapılan ticaret) Çok Tehlikeli
46.75.04 Zirai kimyasal ürünlerin toptanticareti (haşere ilaçları, yabancıot ilaçları, dezenfektanlar, mantarilaçları, çimlenmeyi önleyiciürünler, bitki gelişiminidüzenleyiciler ve diğer ziraikimyasal ürünler) Tehlikeli
46.75.05 Hayvansal veya bitkiselgübrelerin toptan ticareti (açıkalanda yapılan ticaret) Az Tehlikeli
46.76 Diğer ara ürünlerin toptanticareti
46.76.01 Tekstil elyafı toptan ticareti(bükülmemiş ham ipek, yün, hayvankılı, kardelenmiş veya taranmışpamuk, vb.) Az Tehlikeli
46.76.02 Dökme halde kağıt ve mukavvatoptan ticareti (dökme gazetekağıdı, sigara kağıdı, mukavva,karbon kağıdı, tuvalet kağıdı,peçete, vb.) Az Tehlikeli
46.76.03 İşlenmemiş inci, değerli veyarı değerli taşların toptanticareti (sanayi tipi elmaslarhariç) Az Tehlikeli
46.76.04 Birincil formdaki plastik vekauçuk toptan ticareti (etilen,stiren, vinil klorür, akrilik, vb.polimerler ile birincil formdasentetik ve rejenerekauçuklar) Az Tehlikeli
46.76.05 Sanayide kullanım amaçlıplastik poşet, çanta, torba, çuval,vb. ambalaj malzemelerinin toptanticareti Az Tehlikeli
46.76.90 Başka yerde sınıflandırılmamışara ürün (tarım hariç) toptanticareti (korindon, lastik kordbezi, teknik kullanım amaçlıtekstil ürünleri (hortum, konveyörbandı, elek bezi), plastik veyakauçuk levha ve boru, sanayielması, gıda dışı buz, vb.) Az Tehlikeli
46.77 Atık ve hurda toptanticareti
46.77.01 Atık ve hurda toptan ticareti(metal olanlar) (kağıt, cam,plastik vb. ikincil hammaddelerhariç) Tehlikeli
46.77.02 Atık ve hurda toptan ticareti(kağıt, cam, plastik vb. olanlar)(metal olanlar hariç) Az Tehlikeli
46.9 Belirli bir mala tahsisedilmemiş mağazalardaki toptanticaret
46.90 Belirli bir mala tahsisedilmemiş mağazalardaki toptanticaret
46.90.01 Belirli bir mala tahsisedilmemiş mağazalardaki toptanticaret (çeşitli malların toptansatışı) (bir başka ülkeyle yapılantoptan ticaret hariç) Az Tehlikeli
46.90.04 Belirli bir mala tahsisedilmemiş mağazalardaki bir başkaülkeyle yapılan toptan ticaret(çeşitli malların toptansatışı) Az Tehlikeli
47 Perakende ticaret (Motorlu karataşıtları ve motosikletlerhariç)
47.1 Belirli bir mala tahsisedilmemiş mağazalardaki perakendeticaret
47.11 Belirli bir mala tahsisedilmemiş mağazalarda gıda, içecekveya tütün ağırlıklı perakendeticaret
47.11.01 Bakkal ve marketlerde yapılanperakende ticaret (belirli bir malatahsis edilmemiş mağazalarda gıda,içecek veya tütün ağırlıklıperakende ticaret) Az Tehlikeli
47.11.02 Süpermarket ve hipermarketlerdeyapılan perakende ticaret (belirlibir mala tahsis edilmemişmağazalarda gıda, içecek veya tütünağırlıklı perakende ticaret) Az Tehlikeli
47.11.03 Bys. belli bir mala tahsisedilmemiş mağazalarda gıda, içecekveya tütün ağırlıklı perakendeticaret (tanzim satış ve gıdatüketim kooperatifleri dahil) Az Tehlikeli
47.19 Belirli bir mala tahsisedilmemiş mağazalarda yapılan diğerperakende ticaret
47.19.01 Belirli bir mala tahsisedilmemiş mağazalarda yapılan diğerperakende ticaret (giyim eşyası,mobilya, bilgisayar, hırdavat,kozmetik, mücevher, oyuncak vb.reyonları olan mağazalar (gıda,içecek ve tütün ağırlıklıolmayanlar)) Az Tehlikeli
47.2 Belirli bir mala tahsis edilmişmağazalarda gıda, içecek ve tütünperakende ticareti
47.21 Belirli bir mala tahsis edilmişmağazalardaki meyve ve sebzeperakende ticareti
47.21.01 Belirli bir mala tahsis edilmişmağazalarda taze sebze ve meyveperakende ticareti (manav ürünleriile kültür mantarı dahil) Az Tehlikeli
47.21.02 Belirli bir mala tahsis edilmişmağazalarda işlenmiş ve korunmuşmeyve ve sebzelerin perakendeticareti (turşular ile dondurulmuş,salamura edilmiş, konserve vekurutulmuş sebze ve meyveler vb.dahil, baklagil, zeytin vekuruyemiş hariç) Az Tehlikeli
47.21.03 Belirli bir mala tahsis edilmişmağazalarda zeytin perakendeticareti Az Tehlikeli
47.21.04 Belirli bir mala tahsis edilmişmağazalarda kuru bakliyat ürünleriperakende ticareti (fasulye,mercimek, nohut, vb.) Az Tehlikeli
47.21.05 Belirli bir mala tahsis edilmişmağazalarda kuruyemiş perakendeticareti Az Tehlikeli
47.22 Belirli bir mala tahsis edilmişmağazalardaki et ve et ürünlerininperakende ticareti
47.22.01 Belirli bir mala tahsis edilmişmağazalarda et perakende ticareti(sakatatlar, av ve kümes hayvanıetleri ile kasaplar dahil) Tehlikeli
47.22.02 Belirli bir mala tahsis edilmişmağazalarda et ürünleri perakendeticareti (sosis, salam, sucuk,pastırma vb.) Az Tehlikeli
47.23 Belirli bir mala tahsis edilmişmağazalardaki balık, kabukluhayvanlar ve yumuşakçalarınperakende ticareti
47.23.01 Belirli bir mala tahsis edilmişmağazalarda balık, kabukluhayvanlar ve yumuşakçalarınperakende ticareti (canlı, taze,soğutulmuş ve dondurulmuş olanlarile balık filetosu gibi bunlardanyapılan ürünler dahil) Az Tehlikeli
47.24 Belirli bir mala tahsis edilmişmağazalardaki ekmek, pastalar, unlumamuller ve şekerli ürünlerinperakende ticareti
47.24.01 Belirli bir mala tahsis edilmişmağazalarda ekmek, pasta ve unlumamullerin perakende ticareti(ekmek, bisküvi, pasta, çörek,dondurma külahı vb.) Az Tehlikeli
47.24.02 Belirli bir mala tahsis edilmişmağazalarda çikolata ve şekerlemeperakende ticareti (bonbon şekeri,akide şekeri, lokum, helva vb.dahil, dondurma hariç) Az Tehlikeli
47.24.03 Belirli bir mala tahsis edilmişmağazalarda dondurma, aromalıyenilebilir buzlar vb. perakendeticareti (pastanelerde verilenhizmetler hariç) Az Tehlikeli
47.25 Belirli bir mala tahsis edilmişmağazalardaki içeceklerin perakendeticareti
47.25.01 Belirli bir mala tahsis edilmişmağazalarda alkollü ve alkolsüziçeceklerin perakende ticareti(rakı, bira gibi alkollü içkilerile meyve suyu, şıra, şalgam suyu,gazlı içecekler vb. dahil, içmesuyu hariç) Az Tehlikeli
47.25.03 Belirli bir mala tahsis edilmişmağazalarda içme suyu perakendeticareti (şişelendirilmiş veyadamacanaya konulmuş olanlar dahil,şebeke suyu hariç) Az Tehlikeli
47.26 Belirli bir mala tahsis edilmişmağazalardaki tütün ürünlerininperakende ticareti
47.26.01 Belirli bir mala tahsis edilmişmağazalarda tütün ve tütün ürünleriperakende ticareti (nargile tütünü,pipo tütünü, sigara, puro,vb.) Az Tehlikeli
47.26.02 Belirli bir mala tahsis edilmişmağazalarda pipo, nargile, sigaraağızlığı, vb. perakendeticareti Az Tehlikeli
47.29 Belirli bir mala tahsis edilmişmağazalardaki diğer gıdaürünlerinin perakende ticareti
47.29.01 Belirli bir mala tahsis edilmişmağazalarda süt ve süt ürünleriperakende ticareti Az Tehlikeli
47.29.02 Belirli bir mala tahsis edilmişmağazalarda toz, kesme ve kristalşeker perakende ticareti Az Tehlikeli
47.29.03 Belirli bir mala tahsis edilmişmağazalarda çay, kahve, kakao vebaharat perakende ticareti (bitkiçayları dahil) Az Tehlikeli
47.29.04 Belirli bir mala tahsis edilmişmağazalarda yenilebilir katı vesıvı yağların perakende ticareti(yemeklik yağ dahil) Az Tehlikeli
47.29.06 Belirli bir mala tahsis edilmişmağazalarda hububat, un ve zahireürünleri perakende ticareti(bulgur, pirinç, mısır, vb.) Az Tehlikeli
47.29.11 Belirli bir mala tahsis edilmişmağazalarda yumurta perakendeticareti Az Tehlikeli
47.29.12 Belirli bir mala tahsis edilmişmağazalarda homojenize gıdamüstahzarları ve diyetetikürünlerin perakende ticareti(glüten içermeyen gıda maddeleri,sodyum içermeyen tuzlar vb. ilebesin yönünden zenginleştirilmişsporcu gıdaları vb.) Az Tehlikeli
47.29.90 Belirli bir mala tahsis edilmişmağazalarda başka yerdesınıflandırılmamış diğer gıdaürünlerinin perakende ticareti(hazır yemek, gıda tuzu, sos, maya,çorba, pekmez, reçel, fındıkezmesi, makarna, bal, ev hayvanıyemleri vb.) Az Tehlikeli
47.3 Belirli bir mala tahsis edilmişmağazalarda otomotiv yakıtınınperakende ticareti
47.30 Belirli bir mala tahsis edilmişmağazalarda otomotiv yakıtınınperakende ticareti
47.30.01 Belirli bir mala tahsis edilmişmağazalarda motorlu kara taşıtı vemotosiklet yakıtının (benzin,mazot, dizel, biodizel, LPG, CNGvb.) perakende ticareti Çok Tehlikeli
47.30.02 Belirli bir mala tahsis edilmişmağazalarda motorlu kara taşıtlarıiçin yağlama ve soğutma ürünlerininperakende ticareti (madeni yağ,antifriz vb.) Az Tehlikeli
47.4 Belirli bir mala tahsis edilmişmağazalarda bilgi ve iletişimteknolojisi (ICT) teçhizatınınperakende ticareti
47.41 Belirli bir mala tahsis edilmişmağazalarda bilgisayarların, çevredonanımlarının ve yazılımprogramlarının perakendeticareti
47.41.01 Belirli bir mala tahsis edilmişmağazalarda bilgisayarların, çevredonanımlarının ve yazılımlarınperakende ticareti (video oyunkonsolları dahil) Az Tehlikeli
47.42 Belirli bir mala tahsis edilmişmağazalarda telekomünikasyonteçhizatının perakendeticareti
47.42.01 Belirli bir mala tahsis edilmişmağazalarda telekomünikasyonteçhizatının perakende ticareti(telefon, cep telefonu, faksvb.) Az Tehlikeli
47.43 Belirli bir mala tahsis edilmişmağazalarda ses ve görüntücihazlarının perakendeticareti
47.43.01 Belirli bir mala tahsis edilmişmağazalarda ses ve görüntücihazlarının ve bunlarınparçalarının perakende ticareti(radyo, televizyon, müzik seti,teyp, DVD oynatıcı, mp3 çalar,vb.) Az Tehlikeli
47.5 Belirli bir mala tahsis edilmişmağazalarda diğer ev eşyalarınınperakende ticareti
47.51 Belirli bir mala tahsis edilmişmağazalarda tekstil ürünleriperakende ticareti
47.51.02 Belirli bir mala tahsis edilmişmağazalarda kumaş perakendeticareti (manifatura ürünleridahil) Az Tehlikeli
47.51.03 Belirli bir mala tahsis edilmişmağazalarda tuhafiye ürünleriperakende ticareti (iğne, dikişipliği, orlon, düğme, fermuar,çıtçıt, fisto, dantel, gipürvb.) Az Tehlikeli
47.51.04 Belirli bir mala tahsis edilmişmağazalarda goblen veya nakışyapımı için temel materyallerinperakende ticareti Az Tehlikeli
47.51.05 Belirli bir mala tahsis edilmişmağazalarda evde kullanılan tekstiltakımları ve çeşitli tekstilmalzemesinden ev eşyaları perakendeticareti (çarşaf, yatak takımı,yastık kılıfı, masa örtüsü, havlu,battaniye, yorgan, diğermefruşatlar vb.) Az Tehlikeli
47.51.90 Belirli bir mala tahsis edilmişmağazalarda diğer tekstil ürünleriperakende ticareti (tuhafiyeürünleri ve dikiş ipliği hariçdiğer iplikler, gazlı dokumalar,gaz lambası fitili, araba örtülerivb.) Az Tehlikeli
47.52 Belirli bir mala tahsis edilmişmağazalarda hırdavat, boya ve camperakende ticareti
47.52.01 Belirli bir mala tahsis edilmişmağazalarda çimento, alçı, harç,kireç, tuğla, kiremit, briket, taş,kum, çakıl vb. inşaat malzemeleriperakende ticareti Tehlikeli
47.52.02 Belirli bir mala tahsis edilmişmağazalarda hırdavat (nalburiye)malzemesi ve el aletleri perakendeticareti (çivi, vida, kilit,menteşe, çekiç, testere, pense,tornavida, takım tezgahı uçları,perçin, vb.) (tarım ve bahçecilikel aletleri dahil) Az Tehlikeli
47.52.03 Belirli bir mala tahsis edilmişmağazalarda boya, vernik ve lakperakende ticareti Tehlikeli
47.52.04 Belirli bir mala tahsis edilmişmağazalarda düz cam perakendeticareti (pencere camı, cam ayna,emniyet camı, temperli düz cam, çokkatlı yalıtım camları, camdandöşeme blokları, cam tuğlalarvb.) Az Tehlikeli
47.52.05 Belirli bir mala tahsis edilmişmağazalarda metalden kapı, pencereve bunların kasaları ile kapıeşiklerinin perakende ticareti(çelik kapı dahil) Az Tehlikeli
47.52.06 Belirli bir mala tahsis edilmişmağazalarda sıhhi tesisat ve ısıtmatesisatı malzemesi perakendeticareti (lavabo musluğu, vana,valf, tıkaç, t-parçaları,bağlantılar, vb. dahil) (kombilerve radyatörler hariç) Az Tehlikeli
47.52.09 Belirli bir mala tahsis edilmişmağazalarda plastik kapı, pencereve bunların kasaları ile kapıeşikleri, panjurlar, jaluziler,storlar ve benzeri eşyalarınperakende ticareti (PVC olanlardahil) Az Tehlikeli
47.52.10 Belirli bir mala tahsis edilmişmağazalarda ağacın ilkişlenmesinden elde edilen ürünlerinperakende ticareti (kereste, ağaçtalaşı ve yongası, kontrplak, yongave lifli levhalar (mdf, sunta vb.),parke, ahşap varil, fıçı ve diğermuhafazalar, vb.) Tehlikeli
47.52.11 Belirli bir mala tahsis edilmişmağazalarda banyo küveti, lavabo,klozet kapağı, tuvalet taşı verezervuarı ile seramikten karo vefayans vb. sıhhi ürünlerinperakende ticareti (seramik, cam,mermerit, plastik, demir, çelik,bakır vb. dahil, mermer hariç) Az Tehlikeli
47.52.13 Belirli bir mala tahsis edilmişmağazalarda demir/çelikten bar veçubukların, profillerin, tüp veboruların perakende ticareti Tehlikeli
47.52.15 Belirli bir mala tahsis edilmişmağazalarda demirden veya çeliktenmerkezi ısıtma radyatörleri,merkezi ısıtma kazanları (kombilerdahil) ile bunların parçalarınınperakende ticareti (buharjeneratörleri ve kızgın su üretenkazanlar hariç) Az Tehlikeli
47.52.16 Belirli bir mala tahsis edilmişmağazalarda çim biçme ve bahçeekipmanları perakende ticareti (karküreyiciler dahil) (tarım vebahçecilikte kullanılan el aletlerihariç) Az Tehlikeli
47.52.17 Belirli bir mala tahsis edilmişmağazalarda ahşap kapı, pencere vebunların kasaları ile kapıeşiklerinin perakende ticareti Az Tehlikeli
47.52.18 Belirli bir mala tahsis edilmişmağazalarda prefabrik yapılar veyapı elemanlarının perakendeticareti (metalden, betondan,plastikten, ahşaptan vb.) Tehlikeli
47.52.19 Belirli bir mala tahsis edilmişmağazalarda işlenmiş mermer,traverten, kaymaktaşı (su mermeri)ve bunlardan yapılmış ürünlerinperakende ticareti (levha halindeolanlar ile mermer lavabo vb. sıhhiürünler dahil) Az Tehlikeli
47.52.20 Belirli bir mala tahsis edilmişmağazalarda alçı ve alçı esaslıbileşenlerden inşaat amaçlıürünlerin perakende ticareti(kartonpiyer, panel, levhavb.) Az Tehlikeli
47.52.21 Belirli bir mala tahsis edilmişmağazalarda plastikten inşaatamaçlı levhalar, folyolar, şeritlerve borular ile asfalt vb.malzemeden çatı kaplama ürünlerininperakende ticareti (inşaat içinnaylon örtü, shıngle, mantolamaamaçlı strafor vb. dahil) Az Tehlikeli
47.52.22 Belirli bir mala tahsis edilmişmağazalarda masif, lamine velaminant parke perakendeticareti Az Tehlikeli
47.52.90 Belirli bir mala tahsis edilmişmağazalarda başka yerdesınıflandırılmamış inşaat malzemesiperakende ticareti (ev tipi lehimve kaynak makinesi, merdiven,korkuluk, metal veya plastik depo,seramik boru vb. dahil) Az Tehlikeli
47.53 Belirli bir mala tahsis edilmişmağazalarda halı, kilim, duvar veyer kaplamalarının perakendeticareti
47.53.01 Belirli bir mala tahsis edilmişmağazalarda perde, iç stor, perdeveya yatak saçağı ve farbelasıperakende ticareti Az Tehlikeli
47.53.02 Belirli bir mala tahsis edilmişmağazalarda halı, kilim ve diğertekstil yer döşemeleri perakendeticareti (keçeden olanlardahil) Az Tehlikeli
47.53.03 Belirli bir mala tahsis edilmişmağazalarda duvar kağıdı, tekstilduvar kaplamaları, kauçuk yerdöşemeleri ve paspaslar ile plastikzemin, duvar veya tavan kaplamalarıperakende ticareti (linolyum gibielastiki zemin kaplamaları, marley,vb. dahil) Az Tehlikeli
47.54 Belirli bir mala tahsis edilmişmağazalarda elektrikli evaletlerinin perakende ticareti
47.54.01 Belirli bir mala tahsis edilmişmağazalarda beyaz eşya veelektrikli küçük ev aleti perakendeticareti (buzdolabı, çamaşırmakinesi, su ısıtıcı, vantilatör,davlumbaz, tost makinesi, mutfakrobotu, vb.) (radyo, televizyon vefotoğrafçılık ürünleri hariç) Az Tehlikeli
47.54.03 Belirli bir mala tahsis edilmişmağazalarda evde kullanım amaçlıelektrik tesisat malzemesiperakende ticareti (transformatör,sigorta, röle, pil ve batarya,elektrik akümülatörü, koaksiyelkablo, elektrik iletkenleri,anahtar, duy, bys. fiş, priz,vb.) Az Tehlikeli
47.54.90 Belirli bir mala tahsis edilmişmağazalarda bys. elektrikli evaletleri perakende ticareti (evtipi hırsız ve yangın alarmı,tıraş, dikiş, dokuma ve örgümakinesi, fırın, soba, radyatör,vb.) (radyo, TV ve fotoğrafçılıkürünleri hariç) Az Tehlikeli
47.59 Belirli bir mala tahsis edilmişmağazalarda mobilya, aydınlatmateçhizatı ve diğer ev eşyalarınınperakende ticareti
47.59.01 Belirli bir mala tahsis edilmişmağazalarda elektrikli olmayan evaletleri ile çatal bıçak takımı,tabak-çanak, cam eşya, porselen veçömlek ürünleri gibi züccaciyeürünlerinin perakende ticareti(metal tabak-çanak hariç) Az Tehlikeli
47.59.02 Belirli bir mala tahsis edilmişmağazalarda aydınlatma teçhizatıperakende ticareti (lambalar,aydınlatma armatürleri, avize,abajur, ışıklı tabela, portatifelektrik lambaları vb.) (elektrikmalzemeleri hariç) Az Tehlikeli
47.59.03 Belirli bir mala tahsis edilmişmağazalarda ev mobilyalarının veaksesuarlarının perakende ticareti(baza, somya, karyola dahil, hasırve sepetçi söğüdü gibimalzemelerden olanlar hariç) Az Tehlikeli
47.59.04 Belirli bir mala tahsis edilmişmağazalarda ahşap, mantar ve hasıreşyaların perakende ticareti (ahşapsofra ve mutfak eşyaları, ahşapçerçeveler, sepetçi ürünleri,mücevher vb. için ahşap kutular,ahşap biblolar, mantar ürünler,hasır vb.) Az Tehlikeli
47.59.05 Belirli bir mala tahsis edilmişmağazalarda müzik aletleri ve müzikpartisyonu (nota kağıdı) perakendeticareti Az Tehlikeli
47.59.06 Belirli bir mala tahsis edilmişmağazalarda metal sofra ve mutfakeşyası perakende ticareti (düdüklütencere, tencere, cezve, çanak vb.dahil, bakır olanlar ileçatal-bıçak takımı hariç) Az Tehlikeli
47.59.07 Belirli bir mala tahsis edilmişmağazalarda plastikten sofra,mutfak, tuvalet ve diğer eveşyalarının perakende ticareti(plastikten tabak, bardak, torba,kutu, şişe, matara, makara, bobin,mobilya parçaları, vb. dahil) Az Tehlikeli
47.59.08 Belirli bir mala tahsis edilmişmağazalarda büro mobilyaları veaksesuarlarının perakendeticareti Az Tehlikeli
47.59.09 Belirli bir mala tahsis edilmişmağazalarda bakır eşya, bakır sofrave mutfak eşyası perakendeticareti Az Tehlikeli
47.59.10 Belirli bir mala tahsis edilmişmağazalarda bahçe mobilyalarınınperakende ticareti Az Tehlikeli
47.59.11 Belirli bir mala tahsis edilmişmağazalarda yatak perakendeticareti Az Tehlikeli
47.59.12 Belirli bir mala tahsis edilmişmağazalarda kağıt veya mukavvadantuvalet kağıdı, kağıt mendil, kağıthavlular, kağıt masa örtüsü vepeçeteler ile kağıt veya mukavvadantepsi, tabak, kase, bardak vebenzerlerinin perakendeticareti Az Tehlikeli
47.59.13 Belirli bir mala tahsis edilmişmağazalarda elektriksiz havaısıtıcıları veya sıcak havadağıtıcılarının perakende ticareti(soba, kuzine vb. ileparçaları) Az Tehlikeli
47.59.14 Belirli bir mala tahsis edilmişmağazalarda elektriksiz fırın veocaklar ile şofben ve termosifongibi su ısıtıcıları vb.lerininperakende ticareti (gaz, sıvı veyakatı yakıtlı) Az Tehlikeli
47.59.90 Belirli bir mala tahsis edilmişmağazalarda bys. diğer eveşyalarının perakende ticareti (evtipi tartı ve basküller, güneş vebahçe şemsiyeleri, ev tipiçakmaklar ile ev temizliği içinsüpürge ve fırçalar, ev tipi metalkutu, kasa ve çerçeveler, vb.) Az Tehlikeli
47.6 Belirli bir mala tahsis edilmişmağazalarda kültür ve eğlencemallarının perakende ticareti
47.61 Belirli bir mala tahsis edilmişmağazalarda kitapların perakendeticareti
47.61.01 Belirli bir mala tahsis edilmişmağazalarda kitap perakendeticareti (kitap, ansiklopedi,rehber vb. ile CD ve DVDortamındaki kitaplar vb.) Az Tehlikeli
47.62 Belirli bir mala tahsis edilmişmağazalarda gazeteler ve kırtasiyeürünlerinin perakende ticareti
47.62.01 Belirli bir mala tahsis edilmişmağazalarda kırtasiye ürünlerininperakende ticareti Az Tehlikeli
47.62.03 Belirli bir mala tahsis edilmişmağazalarda gazete ve dergilerinperakende ticareti Az Tehlikeli
47.63 Belirli bir mala tahsis edilmişmağazalarda müzik ve videokayıtlarının perakendeticareti
47.63.01 Belirli bir mala tahsis edilmişmağazalarda müzik ve videokayıtlarının perakende ticareti(dolu ses, müzik ve videokasetleri, CD/DVD vb. ürünler ileboş olanlar dahil) Az Tehlikeli
47.64 Belirli bir mala tahsis edilmişmağazalarda spor malzemelerininperakende ticareti
47.64.01 Belirli bir mala tahsis edilmişmağazalarda bys. avcılık vebalıkçılık teçhizatı ilemalzemelerinin perakende ticareti(sportif/avcılık amaçlı tüfekler vemühimmatları ile olta çubuğu,iğnesi ve mantarları ile yapmabalıklar, yapma kuşlar, vb.) Tehlikeli
47.64.02 Belirli bir mala tahsis edilmişmağazalarda motorlu taşıtlardışındaki eğlence ve spor amaçlıtaşıtların perakende ticareti(tekne, yelkenli, kano, kayık, bot,balon, zeplin, vb. ile deniztaşıtları için dıştan takmalımotorlar dahil) Az Tehlikeli
47.64.03 Belirli bir mala tahsis edilmişmağazalarda kamp malzemeleriperakende ticareti (çadır ve uykutulumları dahil) Az Tehlikeli
47.64.05 Belirli bir mala tahsis edilmişmağazalarda bisiklet perakendeticareti Az Tehlikeli
47.64.06 Belirli bir mala tahsis edilmişmağazalarda spor ayakkabısıperakende ticareti (kayak botlarıdahil) Az Tehlikeli
47.64.07 Belirli bir mala tahsis edilmişmağazalarda jimnastik ve atletizmeşya ve ekipmanları ile form tutmamerkezlerine ait eşya veekipmanların perakende ticareti(halter, yürüme bantları, vb.) Az Tehlikeli
47.64.90 Belirli bir mala tahsis edilmişmağazalarda diğer spormalzemelerinin perakende ticareti(paraşütler, rotoşütler,cankurtaran yelekleri, cankurtaransimitleri, spor amaçlı ip veurganlar, binicilik kamçıları,kayak ve patenler vb.) Az Tehlikeli
47.65 Belirli bir mala tahsis edilmişmağazalarda oyunlar ve oyuncaklarınperakende ticareti
47.65.01 Belirli bir mala tahsis edilmişmağazalarda oyun ve oyuncaklarınperakende ticareti (her türlümateryalden yapılmış bebek, oyunkağıdı, havai fişek, jetonlaçalışan diğer oyun makineleri,sihirbazlık veya şaka malzemeleri,vb.) Az Tehlikeli
47.7 Belirli bir mala tahsis edilmişmağazalarda diğer mallarınperakende ticareti
47.71 Belirli bir mala tahsis edilmişmağazalarda giyim eşyalarınınperakende ticareti
47.71.01 Belirli bir mala tahsis edilmişmağazalarda bebek ve çocuk giyimeşyası perakende ticareti (bebek içgiyim eşyaları dahil) Az Tehlikeli
47.71.02 Belirli bir mala tahsis edilmişmağazalarda giysi aksesuarlarıperakende ticareti (eldiven,kravat, şapka, eşarp, şal, mendil,kemer, pantolon askısı, şemsiye,baston, vb. (güneş şemsiyelerihariç)) Az Tehlikeli
47.71.03 Belirli bir mala tahsis edilmişmağazalarda kürklü deriden giyimeşyalarının perakende ticareti(işlenmiş kürklü derilerdahil) Az Tehlikeli
47.71.04 Belirli bir mala tahsis edilmişmağazalarda diğer dış giyimperakende satışı (palto, kaban,anorak, takım elbise, ceket,pantolon, şort (tekstil kumaşındanveya örgü ve tığ işi)) Az Tehlikeli
47.71.05 Belirli bir mala tahsis edilmişmağazalarda iç giyim ve çorapperakende ticareti (gömlek, külot,slip, gecelik, pijama, bornoz,ropdöşambır, kombinezon, iç etek,jüpon, sabahlık, atlet, fanila,sütyen, korse, tişört, külotluçorap, tayt, vb.) Az Tehlikeli
47.71.07 Belirli bir mala tahsis edilmişmağazalarda deri veya deribileşimli giyim eşyası perakendeticareti Az Tehlikeli
47.71.08 Belirli bir mala tahsis edilmişmağazalarda süveter, kazak, hırka,yelek ve benzeri eşyalarınperakende ticareti Az Tehlikeli
47.71.09 Belirli bir mala tahsis edilmişmağazalarda iş giysisi perakendeticareti (endüstriyel ve meslekipantolonlar, bahçıvan tipi iştulumları, binici/külotpantolonları, şortlar, takımlar,ceketler ve blazerler, vb.) Az Tehlikeli
47.71.10 Belirli bir mala tahsis edilmişmağazalarda kullanılmış giysiler veaksesuarlarının perakendeticareti Az Tehlikeli
47.71.11 Belirli bir mala tahsis edilmişmağazalarda spor giysisi perakendeticareti (eşofman, mayo, kayakgiysisi, dağcılık kıyafetleri,vb) Az Tehlikeli
47.71.12 Belirli bir mala tahsis edilmişmağazalarda gelinlik perakendeticareti Az Tehlikeli
47.71.90 Belirli bir mala tahsis edilmişmağazalarda bys. giyim eşyasıperakende ticareti (plastikten,vulkanize kauçuktan, kağıttan,dokusuz kumaştan ya da emdirilmişveya kaplanmış tekstil kumaşındangiysiler) Az Tehlikeli
47.72 Belirli bir mala tahsis edilmişmağazalarda ayakkabı ve derieşyaların perakende ticareti
47.72.01 Belirli bir mala tahsis edilmişmağazalarda ayakkabı, terlik vb.perakende ticareti (kavafiye dahil,spor ayakkabıları ile tamamıtekstilden olanlar hariç) Az Tehlikeli
47.72.02 Belirli bir mala tahsis edilmişmağazalarda bavul, el çantası vediğer seyahat aksesuarlarınınperakende ticareti (deriden, deribileşimlerinden, plastik levhadan,tekstil malzemesinden, vulkanize(ebonit) elyaf veyamukavvadan) Az Tehlikeli
47.72.05 Belirli bir mala tahsis edilmişmağazalarda saraciye ürünleri vekoşum takımı perakende ticareti(eyer, semer, vb.) Az Tehlikeli
47.72.06 Belirli bir mala tahsis edilmişmağazalarda ayakkabı parçalarıperakende ticareti (deri, ayakkabısayası, topuk, topuk yastığı,ayakkabı bağları vb.) Az Tehlikeli
47.72.90 Belirli bir mala tahsis edilmişmağazalarda başka yerdesınıflandırılmamış deriden veyaderi bileşimlerinden diğerürünlerin perakende ticareti (deriveya deri bileşimli giyim eşyasıhariç) Az Tehlikeli
47.73 Belirli bir mala tahsis edilmişmağazalarda eczacılık ürünlerininperakende ticareti
47.73.01 Belirli bir mala tahsis edilmişmağazalarda insan sağlığına yönelikeczacılık ürünlerinin perakendeticareti Az Tehlikeli
47.73.02 Belirli bir mala tahsis edilmişmağazalarda hayvan sağlığınayönelik ilaç, aşı, vb. ürünlerinperakende ticareti Az Tehlikeli
47.74 Belirli bir mala tahsis edilmişmağazalarda tıbbi ve ortopedikürünlerin perakende ticareti
47.74.01 Belirli bir mala tahsis edilmişmağazalarda tıbbi ve ortopedikürünlerin perakende ticareti(gözlük hariç diğer medikal ürünlerdahil) Az Tehlikeli
47.75 Belirli bir mala tahsis edilmişmağazalarda kozmetik ve kişiselbakım malzemelerinin perakendeticareti
47.75.01 Belirli bir mala tahsis edilmişmağazalarda kozmetik ve kişiselbakım malzemelerinin perakendeticareti (diş fırçaları, saçfırçaları, elektriksiz tıraşmakineleri, jilet, ustura,parfümeri ürünleri ve kolonya,doğal sünger, sabun dahil) Az Tehlikeli
47.76 Belirli bir mala tahsis edilmişmağazalarda çiçek, bitki, tohum,gübre, ev hayvanları ve evhayvanları yemleri perakendeticareti
47.76.01 Belirli bir mala tahsis edilmişmağazalarda ev hayvanları ilebunların mama ve gıdalarınınperakende ticareti (süs balıkları,köpek, kuş, hamster, kaplumbağavb., akvaryum, kafes ve kedi veköpekler için tasmalar vb.dahil) Az Tehlikeli
47.76.02 Belirli bir mala tahsis edilmişmağazalarda çiçek, bitki ve tohumperakende ticareti (meyve, sebze veçiçek tohumları, kesme çiçek, dikimbitkileri, canlı bitkiler, yumrularve kökler, aşı kalemleri, mantarmiseli, ağaç fidanları vb.) Az Tehlikeli
47.76.03 Belirli bir mala tahsis edilmişmağazalarda gübre ve zirai kimyasalürünlerin perakende ticareti(turba, kimyasal gübreler,hayvansal veya bitkisel gübreler,haşere ilaçları, yabancı otilaçları vb.) Tehlikeli
47.77 Belirli bir mala tahsis edilmişmağazalarda saat ve mücevherperakende ticareti
47.77.01 Belirli bir mala tahsis edilmişmağazalarda altın ve diğer değerlimetallerden takı, eşya vemücevherat perakende ticareti(kuyumculuk ürünleri perakendeticareti dahil, gümüşten olanlarhariç) Az Tehlikeli
47.77.02 Belirli bir mala tahsis edilmişmağazalarda gümüş takı, eşya vemücevherat perakende ticareti(gümüşçü ürünleri perakendeticareti) Az Tehlikeli
47.77.03 Belirli bir mala tahsis edilmişmağazalarda saat (kol, masa, duvarvb. saatler ile kronometreler)perakende ticareti Az Tehlikeli
47.77.05 Belirli bir mala tahsis edilmişmağazalarda doğal inciden veyakültür incisinden ürünler iledeğerli ya da yarı değerlitaşlardan ürünlerin perakendeticareti (pırlanta, yakut, zümrüt,safir vb.den yapılan ürünler) Az Tehlikeli
47.78 Belirli bir mala tahsis edilmişmağazalarda diğer yeni mallarınperakende ticareti
47.78.01 Belirli bir mala tahsis edilmişmağazalarda pul ve jeton perakendeticareti (özel günlerde çıkarılanpul ve paraların perakende ticaretidahil) Az Tehlikeli
47.78.02 Belirli bir mala tahsis edilmişmağazalarda kömür ve yakacak odunperakende ticareti Az Tehlikeli
47.78.03 Belirli bir mala tahsis edilmişmağazalarda gözlük, kontak lens,gözlük camı vb. perakende ticareti(gözlükçülerin hizmetleri) Az Tehlikeli
47.78.04 Belirli bir mala tahsis edilmişmağazalarda hediyelik eşyaların,elişi ürünlerin ve imitasyontakıların perakende ticareti (sanateserleri hariç) Az Tehlikeli
47.78.05 Belirli bir mala tahsis edilmişmağazalarda silah ve mühimmatperakende ticareti (sportif veavcılık amaçlı olanlar hariç) Tehlikeli
47.78.06 Belirli bir mala tahsis edilmişmağazalarda sanat eserlerininperakende ticareti (ticari sanatgalerilerinin hizmetleri ileressamların, gravürcülerin,heykeltıraşların, bestekarların vediğer sanatçıların orijinalçalışmaları) (antika eşyalarhariç) Az Tehlikeli
47.78.07 Belirli bir mala tahsis edilmişmağazalarda optik ve hassasaletlerin perakende ticareti(mikroskop, dürbün ve pusula dahil,gözlük camı, fotografik ürünlerhariç) Az Tehlikeli
47.78.08 Belirli bir mala tahsis edilmişmağazalarda büro makine veekipmanlarının perakende ticareti(hesaplama makineleri, daktilolar,fotokopi makineleri, tarama ve fakscihazları, çizim masaları vb.) Az Tehlikeli
47.78.09 Belirli bir mala tahsis edilmişmağazalarda evlerde kullanılan fueloil perakende ticareti (dökmeolanlar ile müşterinin istediğiyere ulaştırılarak yapılan doğrudanfuel oil satışı hariç) Tehlikeli
47.78.10 Belirli bir mala tahsis edilmişmağazalarda evlerde kullanılantüpgaz perakende ticareti Çok Tehlikeli
47.78.15 Belirli bir mala tahsis edilmişmağazalarda temizlik malzemesiperakende ticareti (Arap sabunu,deterjan, yumuşatıcılar, şampuanlarvb. dahil, kişisel hijyen içinolanlar hariç) Az Tehlikeli
47.78.16 Belirli bir mala tahsis edilmişmağazalarda yün, tiftik vb.perakende ticareti Az Tehlikeli
47.78.22 Belirli bir mala tahsis edilmişmağazalarda fotoğrafçılıkmalzemeleri ve aletlerininperakende ticareti Az Tehlikeli
47.78.23 Belirli bir mala tahsis edilmişmağazalarda yangın söndürücüler veekipmanlarının perakende ticareti(arabalar için olanlar ve yüksekbasınçlı olanlar hariç) Az Tehlikeli
47.78.26 Belirli bir mala tahsis edilmişmağazalarda yapma çiçek, yaprak vemeyveler ile mum perakendeticareti Az Tehlikeli
47.78.27 Belirli bir mala tahsis edilmişmağazalarda bebek arabaları vebunların parçalarının perakendeticareti Az Tehlikeli
47.78.28 Belirli bir mala tahsis edilmişmağazalarda canlı büyükbaş veküçükbaş hayvanların perakendeticareti (ev hayvanları hariç) Tehlikeli
47.78.29 Belirli bir mala tahsis edilmişmağazalarda canlı kümeshayvanlarının perakendeticareti Tehlikeli
47.78.30 Belirli bir mala tahsis edilmişmağazalarda tekstilden çuval,torba, vb. perakende ticareti (eşyapaketleme amacıylakullanılanlar) Az Tehlikeli
47.78.90 Belirli bir mala tahsis edilmişmağazalarda bys. diğer yeni(kullanılmamış) malların perakendeticareti (sentetik süngerdahil) Az Tehlikeli
47.79 Kullanılmış malların satıldığımağazalardaki perakendeticaret
47.79.01 Belirli bir mala tahsis edilmişmağazalarda antika perakendeticareti Az Tehlikeli
47.79.03 Belirli bir mala tahsis edilmişmağazalarda ikinci el kitaplarınperakende ticareti (sahaflarınfaaliyetleri) Az Tehlikeli
47.79.04 Belirli bir mala tahsis edilmişmağazalarda kullanılmış mobilya,elektrikli ve elektronik ev eşyasıperakende ticareti Az Tehlikeli
47.79.05 Kullanılmış malların müzayedesalonları vasıtasıyla perakendeticareti Az Tehlikeli
47.79.90 Belirli bir mala tahsis edilmişmağazalarda diğer ikinci el eşyaperakende ticareti (ikinci elmotorlu kara taşıtları vemotosiklet parçaları ile giysihariç) Az Tehlikeli
47.8 Tezgahlar ve pazar yerlerivasıtasıyla yapılan perakendeticaret
47.81 Tezgahlar ve pazar yerlerivasıtasıyla gıda, içecek ve tütünürünleri perakende ticareti
47.81.01 Tezgahlar ve pazar yerlerivasıtasıyla alkollü ve alkolsüziçecek perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.02 Tezgahlar ve pazar yerlerivasıtasıyla sebze ve meyve (tazeveya işlenmiş) perakende ticareti(zeytin dahil, seyyar satıcılarhariç) Az Tehlikeli
47.81.03 Tezgahlar ve pazar yerlerivasıtasıyla et ve et ürünleri(sucuk, salam, pastırma, kümeshayvanı eti, vb.) perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.81.04 Tezgahlar ve pazar yerlerivasıtasıyla yumurta perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.81.05 Tezgahlar ve pazar yerlerivasıtasıyla yenilebilir katı vesıvı yağ perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.06 Tezgahlar ve pazar yerlerivasıtasıyla sigara, tütün vb.perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.07 Tezgahlar ve pazar yerlerivasıtasıyla süt ve süt ürünleriperakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.08 Tezgahlar ve pazar yerlerivasıtasıyla balık ve diğer suürünleri perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.09 Tezgahlar ve pazar yerlerivasıtasıyla çay, kahve, kakao,baharat perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.10 Tezgahlar ve pazar yerlerivasıtasıyla fırın ürünleriperakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.81.11 Tezgahlar ve pazar yerlerivasıtasıyla şekerleme perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.81.90 Tezgahlar ve pazar yerlerivasıtasıyla diğer gıda ürünleriperakende ticareti (bal, un, tahıl,pirinç, bakliyat, vb. dahil, seyyarsatıcılar hariç) Az Tehlikeli
47.82 Tezgahlar ve pazar yerlerivasıtasıyla tekstil, giyim eşyasıve ayakkabı perakende ticareti
47.82.01 Tezgahlar ve pazar yerlerivasıtasıyla iç giyim eşyası, dışgiyim eşyası, çorap, giysiaksesuarı ve ayakkabı perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.82.02 Tezgahlar ve pazar yerlerivasıtasıyla tuhafiye, manifatura vemefruşat ürünleri perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.89 Tezgahlar ve pazar yerlerivasıtasıyla diğer mallarınperakende ticareti
47.89.01 Tezgahlar ve pazar yerlerivasıtasıyla ev ve büro mobilyaları(ağaç, metal, vb.) perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.89.02 Tezgahlar ve pazar yerlerivasıtasıyla cam, ayna perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.89.03 Tezgahlar ve pazar yerlerivasıtasıyla canlı büyük ve küçükbaş hayvan perakende ticareti(seyyar satıcılar hariç) Tehlikeli
47.89.04 Tezgahlar ve pazar yerlerivasıtasıyla çiçek, bitki ve bitkitohumu (çiçek toprağı ve saksılarıdahil) perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.89.05 Tezgahlar ve pazar yerlerivasıtasıyla elektrikli alet, cihazve elektrik malzemeleri ile elaletleri perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.89.06 Tezgahlar ve pazar yerlerivasıtasıyla ev hayvanları veyemleri perakende ticareti(muhabbet kuşu, kedi, köpek vb.)(seyyar satıcılar hariç) Tehlikeli
47.89.07 Tezgahlar ve pazar yerlerivasıtasıyla fotoğrafçılıkmalzemeleri perakende ticareti(seyyar satıcılar hariç) Az Tehlikeli
47.89.08 Tezgahlar ve pazar yerlerivasıtasıyla imitasyon takı, süseşyası, turistik ve hediyelik eşyaperakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.89.09 Tezgahlar ve pazar yerlerivasıtasıyla kişisel bakım ürünlerive kozmetik ürünleri perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.89.10 Tezgahlar ve pazar yerlerivasıtasıyla mutfak eşyaları ilebanyo ve tuvalette kullanılaneşyaların perakende ticareti(seyyar satıcılar hariç) Az Tehlikeli
47.89.11 Tezgahlar ve pazar yerlerivasıtasıyla spor malzemeleri, av vekamp malzemeleri perakende ticareti(seyyar satıcılar hariç) Az Tehlikeli
47.89.12 Tezgahlar ve pazar yerlerivasıtasıyla temizlik ürünleri vemalzemeleri perakende ticareti(seyyar satıcılar hariç) Az Tehlikeli
47.89.14 Tezgahlar ve pazar yerlerivasıtasıyla canlı kümes hayvanıperakende ticareti (seyyarsatıcılar hariç) Tehlikeli
47.89.15 Tezgahlar ve pazar yerlerivasıtasıyla kitap perakendeticareti (seyyar satıcılarhariç) Az Tehlikeli
47.89.16 Tezgahlar ve pazar yerlerivasıtasıyla oyun ve oyuncakperakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.89.17 Tezgahlar ve pazar yerlerivasıtasıyla müzik ve video kaset,CD ve DVD’leri perakende ticareti(seyyar satıcılar hariç) Az Tehlikeli
47.89.18 Tezgahlar ve pazar yerlerivasıtasıyla halı, kilim, vb.perakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.89.90 Tezgahlar ve pazar yerlerivasıtasıyla bys. diğer mallarınperakende ticareti (seyyarsatıcılar hariç) Az Tehlikeli
47.9 Mağazalar, tezgahlar ve pazaryerleri dışında yapılan perakendeticaret
47.91 Posta yoluyla veya internetüzerinden yapılan perakendeticaret
47.91.14 Radyo, TV, posta yoluyla veyainternet üzerinden yapılanperakende ticaret Az Tehlikeli
47.99 Mağazalar, tezgahlar ve pazaryerleri dışında yapılan diğerperakende ticaret
47.99.10 Otomatik satış makineleri ileyapılan perakende ticaret Az Tehlikeli
47.99.11 Mağaza, tezgah, pazar yeridışında yapılan perakende ticaret(ev ev dolaşarak veya komisyonculartarafından perakende olarakyapılanlar) (seyyar satıcılardahil, motorlu araçlarla yapılanlarhariç) Az Tehlikeli
47.99.12 Mağaza, tezgah, pazar yeridışında müşterinin istediği yereulaştırılarak yapılan doğrudanyakıt satışı (kalorifer yakıtı,yakacak odun, vb.) Tehlikeli
47.99.13 Mağaza, tezgah, pazar yeridışında motorlu araçlarla çeşitlimalların perakende ticareti Az Tehlikeli
H ULAŞTIRMA VE DEPOLAMA
49 Kara taşımacılığı ve boru hattıtaşımacılığı
49.1 Demir yolu ile şehirler arasıyolcu taşımacılığı
49.10 Demir yolu ile şehirler arasıyolcu taşımacılığı
49.10.01 Demir yolu ile şehirler arasıyolcu taşımacılığı Az Tehlikeli
49.2 Demir yolu ile yüktaşımacılığı
49.20 Demir yolu ile yüktaşımacılığı
49.20.01 Demir yolu ile şehirler arasıve şehiriçi yük taşımacılığı(donmuş ürünlerin, petrolürünlerinin, dökme sıvı vegazların, kuru yüklerin, vb.taşınması) Tehlikeli
49.3 Kara taşımacılığı ile yapılandiğer yolcu taşımacılığı
49.31 Kara taşımacılığı ile yapılanşehir içi ve banliyö yolcutaşımacılığı
49.31.01 Demir yolu, metro, tramvay, vb.ile şehir içi ve banliyö yolcutaşımacılığı (şehir içi ve banliyötaşımacılığının parçası olanfüniküler, teleferik, vb.dahil) Az Tehlikeli
49.31.04 Halk otobüsü ile yapılan şehiriçi ve banliyö yolcutaşımacılığı Az Tehlikeli
49.31.05 Belediye otobüsü ile yapılanşehir içi ve banliyö yolcutaşımacılığı (belediyenin sağladığıhavaalanı otobüsü dahil) Az Tehlikeli
49.31.06 Minibüs ve dolmuş ile yapılanşehir içi ve banliyö yolcutaşımacılığı (belirlenmişgüzergahlarda) Az Tehlikeli
49.31.90 Kara yolu taşımacılığı ileyapılan diğer şehir içi ve banliyöyolcu taşımacılığı (troleybüs, vb.dahil, halk otobüsü, minibüs,belediye otobüsü ile havaalanıotobüsü hariç) (belirlenmişgüzergahlarda) Az Tehlikeli
49.32 Taksi taşımacılığı
49.32.01 Taksi ile yolcu taşımacılığı(dolmuşlar hariç) Az Tehlikeli
49.32.02 Sürücüsü ile birlikte diğerözel araç (otomobil, limuzin, vb.dahil, minibüs, otobüs vb. hariç)kiralama faaliyeti Az Tehlikeli
49.39 Başka yerde sınıflandırılmamışkara taşımacılığı ile yapılan diğeryolcu taşımacılığı
49.39.01 Şehirler arası tarifeli karayolu yolcu taşımacılığı (şehirlerarası otobüs ve tramvay, şehirlerarası personel ve okul servisleri,vb. dahil, şehir içi ve şehirlerarası havaalanı servisleri ileşehir içi havaalanı otobüslerihariç) Az Tehlikeli
49.39.02 Kara yolu şehir içi ve şehirlerarası havaalanı servisleri ileyolcu taşımacılığı Az Tehlikeli
49.39.03 Şehir içi, banliyö ve kırsalalanlarda kara yolu ile personel,öğrenci, vb. grup taşımacılığı(şehir içi personel ve okulservisleri, vb.) Az Tehlikeli
49.39.04 Kara yolu (otobüs, vb.) ileuluslararası yolcutaşımacılığı Az Tehlikeli
49.39.06 Sürücüsü ile birlikte otobüs,minibüs vb. kiralama (belirlenmemişgüzergahlar için) ile geziler içinkara yolu yolcu taşımacılığı (şehirturu otobüsleri, gezi otobüsü, vb.dahil) Az Tehlikeli
49.39.08 İnsanlar veya hayvanlartarafından çekilen taşıtlarla veyayük hayvanları ile yolcutaşımacılığı (fayton, bisiklet, vb.ile yolcu taşımacılığı) Az Tehlikeli
49.39.90 Kablolu trenler (füniküler),teleferikler ve telesiyejler (şehiriçi, banliyö veya metropol transitsistemlerin parçası olanlar hariç)ve diğer şoförlü taşıtlarla başkayerde sınıflandırılmamış kara yoluyolcu taşımacılığı Tehlikeli
49.4 Kara yolu ile yük taşımacılığıve taşımacılık hizmetleri
49.41 Kara yolu ile yüktaşımacılığı
49.41.01 Karayolu ile şehir içi yüktaşımacılığı (gıda, sıvı, kuru yük,vb.) (gaz ve petrol ürünlerihariç) Tehlikeli
49.41.02 Kara yolu ile şehirler arasıyük taşımacılığı (gıda, sıvı, kuruyük, vb.) (gaz ve petrol ürünlerihariç) Tehlikeli
49.41.03 Kara yolu ile uluslararası yüktaşımacılığı (gıda, sıvı, kuru yük,vb.) (gaz ve petrol ürünlerihariç) Tehlikeli
49.41.05 Kara yolu ile canlı hayvantaşımacılığı (çiftlik hayvanları,kümes hayvanları, vahşi hayvanlarvb.) Tehlikeli
49.41.06 Şoförü ile birlikte kamyon vediğer motorlu yük taşımaaraçlarının kiralanması Az Tehlikeli
49.41.07 Karayolu ile insan veya hayvantarafından çekilen taşıtlarla yüktaşımacılığı (tornet, at arabasıvb. ile yük taşımacılığı) Az Tehlikeli
49.41.08 Kara yolu ile şehir içi yüktaşımacılığı (gaz ve petrolürünleri, kimyasal ürünlervb.) Çok Tehlikeli
49.41.09 Kara yolu ile şehirler arasıyük taşımacılığı (gaz ve petrolürünleri, kimyasal ürünlervb.) Çok Tehlikeli
49.41.10 Kara yolu ile uluslararası yüktaşımacılığı (gaz ve petrolürünleri, kimyasal ürünlervb.) Çok Tehlikeli
49.41.90 Kara yolu ile çeşitli taşımatürüne uygun konteyner ve diğer yüktaşımacılığı hizmetleri (evden evenakliyat, vb. hariç) Tehlikeli
49.42 Ev ve iş yerlerine verilentaşımacılık hizmetleri
49.42.01 Kara yolu taşımacılığı ile evve iş yerlerinin taşınması (evdeneve nakliyat, vb.) Tehlikeli
49.5 Boru hattı taşımacılığı
49.50 Boru hattı taşımacılığı
49.50.01 Boru hattı ile ham petrol,rafine petrol ve petrol ürünleritaşımacılığı Çok Tehlikeli
49.50.03 Boru hattı pompa istasyonlarınıişletme hizmetleri Çok Tehlikeli
49.50.04 Boru hattı ile doğalgaztaşımacılığı Çok Tehlikeli
49.50.90 Boru hattı ile diğer mallarıntaşımacılığı (kömür çamuru,kimyasal ürünler, vb.) Çok Tehlikeli
50 Su yolu taşımacılığı
50.1 Deniz ve kıyı sularında yolcutaşımacılığı
50.10 Deniz ve kıyı sularında yolcutaşımacılığı
50.10.12 Deniz ve kıyı sularında yolcugemilerinin ve teknelerininmürettebatıyla birlikte kiralanması(gezinti tekneleri dahil) Tehlikeli
50.10.13 Kıyı sularında yolcularınferibotlarla, kruvaziyer gemilerleve teknelerle taşınması (denizotobüsleri işletmeciliği dahil,uluslararası denizler ile göl venehirlerde yapılanlar hariç) Tehlikeli
50.10.14 Deniz ve kıyı sularında yatişletmeciliği Az Tehlikeli
50.10.15 Deniz ve kıyı sularında geziveya tur bot ve teknelerininişletilmesi (yat işletmeciliğihariç) Tehlikeli
50.10.16 Uluslararası denizlerdeyolcuların gemilerle taşınması Tehlikeli
50.10.90 Deniz ve kıyı sularında diğeryolcu taşımacılığı (deniz taksi vb.dahil) Tehlikeli
50.2 Deniz ve kıyı sularında yüktaşımacılığı
50.20 Deniz ve kıyı sularında yüktaşımacılığı
50.20.17 Uluslararası sularda hampetrolün, petrol ürünlerinin vekimyasalların tanker gemilerletaşınması (gazlar hariç) Çok Tehlikeli
50.20.18 Uluslararası sularda dökme kuruyük taşınması (kimyasallarıntaşınması hariç) Tehlikeli
50.20.19 Uluslararası sularda ve kabotajhattında çekme ve itme hizmetleri(römorkaj) (mavnaların, petrolkulelerinin vb.nin taşınması) (içsular hariç) Tehlikeli
50.20.20 Uluslararası sularda frigorifikgemilerle dondurulmuş veyasoğutulmuş malların taşınması Tehlikeli
50.20.21 Uluslararası sularda çoklutaşıma türüne uygun konteynerlerinkonteyner gemileriyletaşınması Tehlikeli
50.20.22 Uluslararası sularda ve kabotajhattında yük taşımacılığıgemilerinin mürettebatıyla birliktekiralanması (iç sular hariç) Tehlikeli
50.20.23 Uluslararası sularda diğerdökme sıvıların tanker gemilerletaşınması (ham petrolün, petrolürünlerinin, gazların vekimyasalların taşınması hariç) Tehlikeli
50.20.24 Uluslararası sularda gazlarıntanker gemilerle taşınması Çok Tehlikeli
50.20.25 Kabotaj hattında ham petrolün,petrol ürünlerinin ve kimyasallarıntanker gemilerle taşınması (gazlarhariç) (iç sular hariç) Çok Tehlikeli
50.20.26 Kabotaj hattında dökme kuru yüktaşınması (kimyasalların taşınmasıhariç) (iç sular hariç) Tehlikeli
50.20.27 Kabotaj hattında frigorifikgemilerle dondurulmuş veyasoğutulmuş malların taşınması (içsular hariç) Tehlikeli
50.20.28 Kabotaj hattında çoklu taşımatürüne uygun konteynerlerinkonteyner gemileriyle taşınması (içsular hariç) Tehlikeli
50.20.29 Kabotaj hattında diğersıvıların tanker gemilerletaşınması (ham petrolün, petrolürünlerinin, gazların vekimyasalların taşınması hariç) (içsular hariç) Tehlikeli
50.20.30 Kabotaj hattında gazlarıntanker gemilerle taşınması (içsular hariç) Çok Tehlikeli
50.20.90 Uluslararası sularda yapılandiğer yük taşımacılığı Tehlikeli
50.20.91 Kabotaj hattında yapılan diğeryük taşımacılığı (iç sularhariç) Tehlikeli
50.3 İç sularda yolcutaşımacılığı
50.30 İç sularda yolcutaşımacılığı
50.30.08 İç sularda yolcu taşımacılığı(nehir, kanal ve göllerdeyapılanlar, vb.) (gezinti amaçlıolanlar dahil) Tehlikeli
50.30.09 İç sularda yolcu taşımagemilerinin ve teknelerininmürettebatıyla birliktekiralanması Tehlikeli
50.4 İç sularda yüktaşımacılığı
50.40 İç sularda yüktaşımacılığı
50.40.05 İç sularda yük taşımacılığı(nehir, kanal ve göllerdeyapılanlar, vb.) Tehlikeli
50.40.07 İç sularda yük taşıma gemi veteknelerinin mürettebatıylabirlikte kiralanması hizmetleri(nehir, kanal ve göllerde,vb.) Tehlikeli
50.40.08 İç sularda çekme ve itmehizmetleri (römorkaj) (mavnaların,şamandıraların vb.nin taşınması)(nehir, kanal ve göllerde,vb.) Tehlikeli
51 Hava yolu taşımacılığı
51.1 Hava yolu ile yolcutaşımacılığı
51.10 Hava yolu ile yolcutaşımacılığı
51.10.01 Hava yolu yolcu taşımacılığı(tarifeli olanlar) Tehlikeli
51.10.02 Hava yolu yolcu taşımacılığı(turistik ve gezi amaçlı olanlarile tarifesiz olanlar) (hava taksitaşımacılığı dahil) Tehlikeli
51.10.03 Hava yolu yolcu taşımaaraçlarının mürettebatıyla birliktekiralanması Tehlikeli
51.2 Hava yolu ile yük taşımacılığıve uzay taşımacılığı
51.21 Hava yolu ile yüktaşımacılığı
51.21.17 Hava yolu ile yüktaşımacılığı Tehlikeli
51.22 Uzay taşımacılığı
51.22.02 Uzay taşımacılığı (uyduların veuzay taşıtlarının fırlatılması, yükve yolcuların uzaya taşınması) Çok Tehlikeli
52 Taşımacılık için depolama vedestekleyici faaliyetler
52.1 Depolama ve ambarlama
52.10 Depolama ve ambarlama
52.10.02 Frigorifik depolama veantrepoculuk faaliyetleri(bozulabilir gıda ürünleri dahildondurulmuş veya soğutulmuş mallariçin depolama) Tehlikeli
52.10.03 Hububat depolama veantrepoculuk faaliyetleri (hububatsilolarının işletilmesi vb.) Tehlikeli
52.10.04 Petrol, petrol ürünleri,kimyasallar, gaz, vb. depolama veantrepoculuk faaliyetleri Çok Tehlikeli
52.10.05 Dökme sıvı depolama veantrepoculuk faaliyetleri (yağ,şarap, vb. dahil, petrol, petrolürünleri, kimyasallar, gaz, vb.hariç) Tehlikeli
52.10.90 Diğer depolama ve antrepoculukfaaliyetleri (frigorifik depolarile hububat, kimyasallar, dökmesıvı ve gaz depolama faaliyetlerihariç) Tehlikeli
52.2 Taşımacılık için destekleyicifaaliyetler
52.21 Kara taşımacılığınıdestekleyici hizmetfaaliyetleri
52.21.04 Kara yolu taşımacılığı ileilgili özel ve ticari araçlar içinçekme ve yol yardımıfaaliyetleri Tehlikeli
52.21.05 Demir yolu taşımacılığınıdestekleyici faaliyetler (demiryolu çekme ve itme hizmetleri,manevra ve makas değiştirmehizmetleri, demir yolu terminalhizmetleri vb. dahil, emanetçilikhariç) Az Tehlikeli
52.21.06 Kara taşımacılığına yönelikemanet büroları işletmeciliği(demir yollarında yapılanlardahil) Tehlikeli
52.21.07 Otopark ve garaj işletmeciliği(bisiklet parkları ve karavanlarınkışın saklanması dahil) Az Tehlikeli
52.21.08 Otoyol, tünel ve köprüişletmeciliği Az Tehlikeli
52.21.09 Kara yolu yolcu taşımacılığınayönelik otobüs terminalhizmetleri Az Tehlikeli
52.21.10 Kara yolu yolcu taşımacılığınayönelik otobüs, minibüs ve taksiduraklarının işletilmesi (otobüsterminal hizmetleri hariç) Az Tehlikeli
52.21.12 Kara taşımacılığınıdestekleyici olarak gazlarınsıvılaştırılması Çok Tehlikeli
52.21.13 Yolcu taşımacılığıkooperatiflerinin faaliyetleri Az Tehlikeli
52.21.90 Kara taşımacılığınıdestekleyici diğer hizmetler(kamyon terminal işletmeciliğidahil) Az Tehlikeli
52.22 Su yolu taşımacılığınıdestekleyici hizmetfaaliyetleri
52.22.06 Su yolu taşımacılığınıdestekleyici olarak liman ve suyollarının işletilmesi (limanların,iskelelerin, rıhtımların, su yoluhavuzlarının, deniz terminallerininvb. işletilmesi) (deniz feneri,fener dubası vb. işletilmesihariç) Tehlikeli
52.22.07 Su yolu taşımacılığınıdestekleyici olarak deniz feneri,fener dubası, fener gemisi,şamandıra, kanal işaretleri vb.seyir yardımcıları ile verilenhizmet faaliyetleri Az Tehlikeli
52.22.08 Deniz ve kıyı suları ile içsularda kılavuzluk ve rıhtımayanaştırma faaliyetleri (gemininhavuzlanması ve havuzdançıkarılması dahil) Tehlikeli
52.22.10 Deniz ve kıyı suları ile içsularda gemi kurtarma ve tekraryüzdürme faaliyetleri (zordurumdaki gemilerin çekilmesi, bugemilerin ve kargolarınınkurtarılması vb.) Tehlikeli
52.22.90 Su taşımacılığını destekleyicidiğer hizmetler Tehlikeli
52.23 Hava yolu taşımacılığınıdestekleyici hizmetfaaliyetleri
52.23.03 Havaalanı yer hizmetfaaliyetleri (kargo ve bagajyükleme boşaltma hizmetlerihariç) Tehlikeli
52.23.04 Havaalanı işletmeciliği (uçakpisti işletme hizmetleri ve havayolu yolcu terminali hizmetleridahil, havaalanı yer hizmetlerihariç) Az Tehlikeli
52.23.06 Hava trafik kontrol hizmetleri(havaalanında yer alan kule veradar istasyonları tarafındansağlanan hizmetler dahil) Tehlikeli
52.23.07 Uzay taşımacılığınıdestekleyici hizmetler Çok Tehlikeli
52.23.90 Hava taşımacılığınıdestekleyici diğer faaliyetler(havaalanlarında yangın söndürme veyangın önleme faaliyetleri, havataşıtlarının çekilmesi, vb.) Çok Tehlikeli
52.24 Kargo yükleme boşaltmahizmetleri
52.24.08 Su yolu taşımacılığıyla ilgilikargo ve bagaj yükleme boşaltmahizmetleri (konteyner yüklemeboşaltma hizmetleri dahil) Tehlikeli
52.24.09 Hava yolu taşımacılığıylailgili kargo ve bagaj yüklemeboşaltma hizmetleri Tehlikeli
52.24.10 Kara yolu taşımacılığıylailgili kargo yükleme boşaltmahizmetleri Tehlikeli
52.24.11 Demir yolu taşımacılığıylailgili kargo yükleme boşaltmahizmetleri Tehlikeli
52.29 Taşımacılığı destekleyici diğerfaaliyetler
52.29.01 Deniz yolu yük nakliyatkomisyoncularının faaliyetleri Az Tehlikeli
52.29.02 Uluslararası deniz yolu yüknakliyat acentelerininfaaliyetleri Az Tehlikeli
52.29.03 Hava yolu yük nakliyatacentelerinin faaliyetleri Az Tehlikeli
52.29.04 Gümrük komisyoncularınınfaaliyetleri Az Tehlikeli
52.29.05 Kantar hizmetleri (yüklüaraçların tartılması, vb.) Az Tehlikeli
52.29.06 Kara yolu yük nakliyatacentelerinin faaliyetleri Az Tehlikeli
52.29.07 Kara yolu yük nakliyatkomisyoncularının faaliyetleri Az Tehlikeli
52.29.09 Yetkili gümrük müşavirliği veyagümrük müşavirliği Az Tehlikeli
52.29.11 Taşıma belgelerinin veirsaliyelerin düzenlenmesi vetedarik edilmesi Az Tehlikeli
52.29.13 Hava yolu yük nakliyatkomisyoncularının faaliyetleri Az Tehlikeli
52.29.14 Demir yolu yük nakliyatacentelerinin faaliyetleri Az Tehlikeli
52.29.15 Demir yolu yük nakliyatkomisyoncularının faaliyetleri Az Tehlikeli
52.29.16 Taşınan malların kasalardan,sandıklardan vb.lerindençıkarılması, numune alınması,incelenmesi vb. faaliyetler Az Tehlikeli
52.29.17 Yük taşımacılığıkooperatiflerinin faaliyetleri Az Tehlikeli
52.29.18 Kabotaj hattı deniz yolu yüknakliyat acentelerininfaaliyetleri Az Tehlikeli
52.29.90 Bys. taşımacılığı destekleyicidiğer faaliyetler (grupsevkiyatının organizasyonu,malların taşınması sırasındakorunması için geçici olarakkasalara vb. yerleştirilmesi,yüklerin birleştirilmesi,gruplanması ve parçalaraayırılması, vb. dahil) Tehlikeli
53 Posta ve kuryefaaliyetleri
53.1 Evrensel hizmet yükümlülüğüaltında postacılıkfaaliyetleri
53.10 Evrensel hizmet yükümlülüğüaltında postacılıkfaaliyetleri
53.10.01 Evrensel hizmet yükümlülüğüaltında postacılık faaliyetleri(kargo ve kurye şirketlerininfaaliyetleri hariç) Az Tehlikeli
53.2 Diğer posta ve kuryefaaliyetleri
53.20 Diğer posta ve kuryefaaliyetleri
53.20.08 Gıda, mobilya vb. satın alınanşeylere ilişkin evlere dağıtımfaaliyetleri (şehir içi yüktaşımacılığı ve evden eve nakliyatvb. hariç) Tehlikeli
53.20.09 Kurye faaliyetleri (kara, denizve hava yolu ile yapılanlar dahil,evrensel hizmet yükümlülüğü altındapostacılık faaliyetleri hariç) Az Tehlikeli
53.20.10 Paket ve koli gibi kargolarıntoplanması, sınıflandırılması,taşınması ve dağıtımı faaliyetleri(dökme yükler ve evrensel hizmetyükümlülüğü altında postacılıkfaaliyetleri hariç) Tehlikeli
I KONAKLAMA VE YİYECEK HİZMETİFAALİYETLERİ
55 Konaklama
55.1 Oteller ve benzeri konaklamayerleri
55.10 Oteller ve benzeri konaklamayerleri
55.10.02 Otel vb. konaklama yerlerininfaaliyetleri (günlük temizlik veyatak yapma hizmeti sağlananyerlerin faaliyetleri) (kendimüşterilerine restoran hizmetivermeyenler ile devre mülklerhariç) Az Tehlikeli
55.10.05 Otel vb. konaklama yerlerininfaaliyetleri (günlük temizlik veyatak yapma hizmeti sağlananyerlerin faaliyetleri) (kendimüşterilerine restoran hizmetiverenler ile devre mülklerhariç) Az Tehlikeli
55.2 Tatil ve diğer kısa sürelikonaklama yerleri
55.20 Tatil ve diğer kısa sürelikonaklama yerleri
55.20.01 Tatil ve diğer kısa sürelikonaklama faaliyetleri (hosteller,devre mülkler, tatil evleri, apartoteller, bungalov, dağ evleri,vb.nde) (günlük temizlik ve yatakyapma hizmeti sağlanan oda veyasüit konaklama faaliyetlerihariç) Az Tehlikeli
55.20.03 Kendine ait veya kiralanmışmobilyalı evlerde bir aydan dahakısa süreli olarak konaklamafaaliyetleri Az Tehlikeli
55.20.04 Tatil amaçlı pansiyonlarınfaaliyetleri Az Tehlikeli
55.3 Kamp alanları, motorlu karavanve karavan tipi treyler (römork)park hizmetleri
55.30 Kamp alanları, motorlu karavanve karavan tipi treyler (römork)park hizmetleri
55.30.36 Kamp alanlarının, motorlukaravan, vb. için park yerlerininfaaliyetleri (çadır veya karavanile kamp kurma amaçlı açık havatesisi sağlanması, yetişkinler veyaçocuklar için kamp programlarındave avcılık kamplarında konaklamahizmetinin sağlanması, vb.) Az Tehlikeli
55.9 Diğer konaklama yerleri
55.90 Diğer konaklama yerleri
55.90.01 Öğrenci ve işçi yurtları,pansiyonlar ve odası kiralananevlerde yapılan konaklamafaaliyetleri (tatil amaçlı olanlarhariç) Az Tehlikeli
55.90.02 Misafirhaneler, ordu evi, polisevi ve öğretmen evleri ile eğitimve dinlenme tesisleri gibikonaklama yerlerininfaaliyetleri Az Tehlikeli
55.90.03 Diğer konaklama yerlerininfaaliyetleri (başka bir birimtarafından işletildiğinde yataklıvagonlar, vb. dahil,misafirhaneler, öğretmen evi, vb.hariç) Az Tehlikeli
56 Yiyecek ve içecek hizmetifaaliyetleri
56.1 Lokantalar ve seyyar yemekhizmeti faaliyetleri
56.10 Lokantalar ve seyyar yemekhizmeti faaliyetleri
56.10.01 Seyyar yemek servisifaaliyetleri (simit, poğaça, börek,kokoreç, nohut-pilav, piyaz,dondurma, vb. ile kayıklardayapılanlar dahil) Az Tehlikeli
56.10.02 Börekçilerin faaliyetleri(imalatçıların faaliyetleri ileseyyar olanlar hariç) Az Tehlikeli
56.10.03 Çorbacıların ve işkembecilerinfaaliyetleri (imalatçılarınfaaliyetleri ile seyyar olanlarhariç) Az Tehlikeli
56.10.04 Dondurmacıların faaliyetleri(imalatçıların faaliyetleri ileseyyar olanlar hariç) Az Tehlikeli
56.10.05 Oturacak yeri olmayan fast-foodsatış yerleri (hamburger, sandviç,tost, vb.), al götür tesisleri vebenzerleri tarafından sağlanandiğer yemek hazırlama ve sunumfaaliyetleri Az Tehlikeli
56.10.06 Döner, lahmacun ve pidecilikfaaliyeti (garson servisi sunanlarile self servis sunanlar dahil,imalatçıların ve al götürtesislerin faaliyetleri ile seyyarolanlar hariç) Az Tehlikeli
56.10.07 Ciğer, kokoreç, köfte vekebapçıların faaliyeti (garsonservisi sunanlar ile self servissunanlar dahil, imalatçıların ve algötür tesislerin faaliyetleri ileseyyar olanlar hariç) Az Tehlikeli
56.10.08 Diğer lokanta ve restoranların(içkili ve içkisiz) faaliyetleri(garson servisi sunanlar ile selfservis sunanlar dahil,imalatçıların ve al götürtesislerin faaliyetleri ile seyyarolanlar hariç) Az Tehlikeli
56.10.09 Pastanelerin ve tatlıcılarınfaaliyeti (garson servisi sunanlarile self servis sunanlar dahil,imalatçıların ve al götürtesislerin faaliyetleri ile seyyarolanlar hariç) Az Tehlikeli
56.10.10 Pizzacıların faaliyeti (garsonservisi sunanlar ile self servissunanlar dahil, imalatçıların ve algötür tesislerin faaliyetleri ileseyyar olanlar hariç) Az Tehlikeli
56.10.14 Başka birimler tarafındanişletildiğinde gemi ve trenlerderestoran işletmeciliği (yemeklivagon, vb.) Az Tehlikeli
56.10.17 Mantıcı ve gözlemecilerinfaaliyeti (garson servisi sunanlarile self servis sunanlar dahil,imalatçıların ve al götürtesislerin faaliyetleri ile seyyarolanlar hariç) Az Tehlikeli
56.10.18 Oturacak yeri olan fast-foodsatış yerleri (hamburger, sandviç,tost, vb.) tarafından sağlananyemek hazırlama ve sunumfaaliyetleri Az Tehlikeli
56.10.19 Yiyecek ağırlıklı hizmet verenkafeteryaların faaliyetleri Az Tehlikeli
56.2 Dışarıya yemek hizmeti sunanişletmelerin (catering)faaliyetleri ve diğer yiyecekhizmetleri faaliyetleri
56.21 Özel günlerde dışarıya yemekhizmeti sunan işletmelerinfaaliyetleri
56.21.01 Özel günlerde dışarıya yemeksunan işletmelerinfaaliyetleri Az Tehlikeli
56.29 Diğer yiyecek hizmetifaaliyetleri
56.29.01 Kantinlerin faaliyetleri (spor,fabrika, okul veya işyerikantinleri, vb.) Az Tehlikeli
56.29.03 Hava yolu şirketleri ve diğerulaştırma şirketleri içinsözleşmeye bağlı düzenlemeleredayalı olarak yiyecek hazırlanmasıve temini hizmetleri Az Tehlikeli
56.29.90 Dışarıya yemek sunan diğerişletmelerin faaliyetleri (spor,fabrika, işyeri, üniversite, vb.mensupları için tabldot servisi,vb. dahil, özel günlerde hizmetverenler hariç) Az Tehlikeli
56.3 İçecek sunum hizmetleri
56.30 İçecek sunum hizmetleri
56.30.02 Çay ocakları, kıraathaneler,kahvehaneler, kafeler, meyve suyusalonları ve çay bahçelerindeiçecek sunum faaliyeti Az Tehlikeli
56.30.03 Lokallerde içecek sunumfaaliyeti (alkollü-alkolsüz) Az Tehlikeli
56.30.04 Bar, meyhane ve birahanelerdeiçecek sunum faaliyetleri(alkollü-alkolsüz) Tehlikeli
56.30.05 Gazino, gece kulübü, taverna,diskotek, kokteyl salonları, vb.yerlerde içecek sunum faaliyetleri(alkollü-alkolsüz) Tehlikeli
56.30.06 Trenlerde ve gemilerdeişletilen barların faaliyetleri(alkollü-alkolsüz) Az Tehlikeli
56.30.08 Boza, şalgam ve sahlep sunumfaaliyeti Az Tehlikeli
56.30.90 Seyyar içecek satanlar ilediğer içecek sunumfaaliyetleri Az Tehlikeli
J BİLGİ VE İLETİŞİM
58 Yayımcılık faaliyetleri
58.1 Kitapların, süreli yayınlarınyayımlanması ve diğer yayımcılıkfaaliyetleri
58.11 Kitap yayımı
58.11.01 Kitap yayımı (broşür, risale,ansiklopedi, vb. dahil, çocukkitaplarının, ders kitaplarının veyardımcı ders kitaplarınınyayımlanması hariç) Az Tehlikeli
58.11.03 Çocuk kitaplarınınyayımlanması Az Tehlikeli
58.11.04 Ders kitaplarının ve yardımcıders kitaplarının yayımlanması(sözlük, atlas, grafikler,haritalar vb. dahil) Az Tehlikeli
58.12 Rehberlerin ve posta adreslistelerinin yayımlanması
58.12.01 Rehberlerin ve posta adreslistelerinin yayımlanması (telefonrehberleri, iş ve ticaretrehberleri, belediye ve şehirrehberleri, vb.) Az Tehlikeli
58.13 Gazetelerin yayımlanması
58.13.01 Gazetelerin yayımlanması(haftada en az dört kezyayımlananlar) (reklam gazeteleridahil) Az Tehlikeli
58.14 Dergi ve süreli yayınlarınyayımlanması
58.14.02 Eğitime destek amaçlı dergi vesüreli yayınların yayımlanması(haftada dörtten azyayımlananlar) Az Tehlikeli
58.14.03 Bilimsel, teknik, kültürel vb.dergi ve süreli yayınlarınyayımlanması (haftada dörtten azyayımlananlar) Az Tehlikeli
58.14.90 Diğer dergi ve süreliyayınların yayımlanması (haftadadörtten az yayımlananlar) (çizgiroman, magazin dergileri vb.) Az Tehlikeli
58.19 Diğer yayıncılıkfaaliyetleri
58.19.04 Değerli kağıtların yayımlanmasıfaaliyetleri (pul, tahvil, hissesenedi, bono veya senet vb. değerlikağıtlar) Az Tehlikeli
58.19.90 Bys. diğer yayıncılıkfaaliyetleri (kartpostal, tebrikkartları vb. ile katalog, poster,reklam materyali vb.) Az Tehlikeli
58.2 Yazılım programlarınınyayımlanması
58.21 Bilgisayar oyunlarınınyayımlanması
58.21.01 Bilgisayar oyunlarınınyayımlanması Az Tehlikeli
58.29 Diğer yazılım programlarınınyayımlanması
58.29.01 Diğer yazılım programlarınınyayımlanması Az Tehlikeli
59 Sinema filmi, video vetelevizyon programları yapımcılığı,ses kaydı ve müzik yayımlamafaaliyetleri
59.1 Sinema filmi, video vetelevizyon programıfaaliyetleri
59.11 Sinema filmi, video vetelevizyon programları yapımfaaliyetleri
59.11.03 Sinema filmi, video vetelevizyon programları yapımfaaliyetleri (belgesel yapımcılığıdahil) Az Tehlikeli
59.12 Sinema filmi, video vetelevizyon programları çekimsonrası faaliyetleri
59.12.01 Sinema filmi, video vetelevizyon programları çekimsonrası faaliyetleri (ses-görüntüredaksiyonu, asıl kopyalarınaktarımı, renk düzeltme, sayısaliyileştirme, görsel efekt,animasyon, alt yazı,başlıklandırma, grafik, vb.işler) Az Tehlikeli
59.13 Sinema filmi, video vetelevizyon programları dağıtımfaaliyetleri
59.13.02 Sinema filmi, video vetelevizyon programları dağıtımfaaliyetleri (film hakları vegelirleri için lisanslamahizmetleri, çalışmaların gösterimi,yayımlanması ve kiralanması içinizin verilmesi, elde edilengelirlerin dağıtılması vb.) Az Tehlikeli
59.14td> Sinema filmi gösterimfaaliyetleri
59.14.02 Sinema filmi gösterimfaaliyetleri Az Tehlikeli
59.2 Ses kaydı ve müzik yayıncılığıfaaliyetleri
59.20 Ses kaydı ve müzik yayıncılığıfaaliyetleri
59.20.01 Müzik yayımcılığı faaliyetleri(basılı müzik notaları, elektronikformdaki müzikal besteler, müzikalses diskleri, indirilebilirmüzikler vb.) Az Tehlikeli
59.20.02 Ses kayıt ve canlı kayıtfaaliyetleri (seslerin, sözlerin vemüziğin ses kayıt stüdyosunun özelteknik ekipmanları kullanılarakkaydedilmesi ile konferans,seminer, konser vb. canlıetkinliklerde yapılan kayıthizmetleri vb.) Tehlikeli
59.20.03 Orijinal ses kayıtlarınıkullanım hakkı için lisanslamafaaliyetleri Az Tehlikeli
59.20.06 Radyo programı yapımcılıkfaaliyetleri Az Tehlikeli
60 Programcılık ve yayıncılıkfaaliyetleri
60.1 Radyo yayıncılığı
60.10 Radyo yayıncılığı
60.10.09 Radyo yayıncılığı (radyo yayınstüdyoları vb.) Az Tehlikeli
60.2 Televizyon programcılığı veyayıncılığı faaliyetleri
60.20 Televizyon programcılığı veyayıncılığı faaliyetleri
60.20.01 Televizyon programcılığı veyayıncılığı faaliyetleri Az Tehlikeli
61 Telekomünikasyon
61.1 Kablolu telekomünikasyonfaaliyetleri
61.10 Kablolu telekomünikasyonfaaliyetleri
61.10.15 Kablolu telekomünikasyonfaaliyetleri (kablolu ağlarüzerinden internet erişimininsağlanması hariç) Az Tehlikeli
61.10.17 Kablolu ağlar üzerindeninternet erişiminin sağlanması Az Tehlikeli
61.2 Kablosuz telekomünikasyonfaaliyetleri
61.20 Kablosuz telekomünikasyonfaaliyetleri
61.20.02 Kablosuz telekomünikasyonfaaliyetleri (kablosuz ağlarüzerinden internet erişimininsağlanması ve uydu üzerindenyapılanlar hariç) Az Tehlikeli
61.20.03 Kablosuz ağlar üzerindeninternet erişiminin sağlanması Az Tehlikeli
61.3 Uydu üzerinden telekomünikasyonfaaliyetleri
61.30 Uydu üzerinden telekomünikasyonfaaliyetleri
61.30.01 Uydu üzerinden telekomünikasyonfaaliyetleri Tehlikeli
61.9 Diğer telekomünikasyonfaaliyetleri
61.90 Diğer telekomünikasyonfaaliyetleri
61.90.04 Telekomünikasyon uygulamalarınayönelik radar istasyonlarınınişletilmesi Tehlikeli
61.90.05 İnternet kafelerinfaaliyetleri Az Tehlikeli
61.90.07 Telekomünikasyon hizmetiyeniden satıcılarınınfaaliyetleri Az Tehlikeli
61.90.90 Bys. diğer telekomünikasyonfaaliyetleri (uydudan izleme,iletişim telemetresi vb. uzmanlıkgerektiren telekomünikasyonuygulamalarının sağlanması, çevrimiçi internet erişimi sağlanması,VOIP sağlanması, vb.) Tehlikeli
62 Bilgisayar programlama,danışmanlık ve ilgilifaaliyetler
62.0 Bilgisayar programlama,danışmanlık ve ilgilifaaliyetler
62.01 Bilgisayar programlamafaaliyetleri
62.01.01 Bilgisayar programlamafaaliyetleri (sistem, veri tabanı,network, web sayfası vb.yazılımları ile müşteriye özelyazılımların kodlanması vb) Az Tehlikeli
62.02 Bilgisayar danışmanlıkfaaliyetleri
62.02.01 Bilgisayar danışmanlıkfaaliyetleri (donanımgereksinimleri gibi donanımlailgili bilişim konularında uzmangörüşü sağlanması, bilgisayargereksinimlerinin belirlenmesi,bilgisayar sistemlerininplanlanması ve tasarlanmasıvb.) Az Tehlikeli
62.03 Bilgisayar tesisleri yönetimfaaliyetleri
62.03.01 Bilgisayar tesisleri yönetimfaaliyetleri Az Tehlikeli
62.09 Diğer bilgi teknolojisi vebilgisayar hizmet faaliyetleri
62.09.01 Bilgisayarları felakettenkurtarma ve veri kurtarmafaaliyetleri Az Tehlikeli
62.09.02 Diğer bilgi teknolojisi vebilgisayar hizmet faaliyetleri(kişisel bilgisayarların ve çevrebirimlerinin kurulumu, yazılımkurma vb.) Az Tehlikeli
63 Bilgi hizmet faaliyetleri
63.1 Veri işleme, barındırma veilgili faaliyetler; webportalları
63.11 Veri işleme, barındırma veilgili faaliyetler
63.11.08 Veri işleme, barındırma veilgili faaliyetler (veri girişi,verinin işlenmesi, özel raporlarınoluşturulması, depolanması,vb.) Az Tehlikeli
63.12 Web portalları
63.12.01 Web portalı faaliyetleri Az Tehlikeli
63.9 Diğer bilgi hizmetfaaliyetleri
63.91 Haber ajanslarınınfaaliyetleri
63.91.01 Haber ajanslarının faaliyetleri(medya için haber, resim veröportaj tedarik eden haber bürosuve haber ajanslarınınfaaliyetleri) Az Tehlikeli
63.99 Başka yerde sınıflandırılmamışdiğer bilgi hizmetfaaliyetleri
63.99.01 Başka yerde sınıflandırılmamışdiğer bilgi hizmet faaliyetleri(bilgi araştırma hizmetleri, gazetekupürleri hizmetleri vb.) Az Tehlikeli
K FİNANS VE SİGORTAFAALİYETLERİ
64 Finansal hizmet faaliyetleri(Sigorta ve emeklilik fonlarıhariç)
64.1 Parasal aracı kuruluşlarınfaaliyetleri
64.11 Merkez bankasıfaaliyetleri
64.11.06 Merkez bankasıfaaliyetleri Az Tehlikeli
64.19 Diğer parasal aracılıkfaaliyetleri
64.19.01 Bankaların faaliyetleri(katılım bankaları, mevduatbankaları, kredi birlikleri vb.dahil, merkez bankası ve yatırımbankaları hariç) Az Tehlikeli
64.2 Holding şirketlerininfaaliyetleri
64.20 Holding şirketlerininfaaliyetleri
64.20.19 Holding şirketlerininfaaliyetleri (bağlı iştirakleriniyönetenler hariç) Az Tehlikeli
64.3 Trustlar, fonlar ve benzerimali varlıklar
64.30 Trustlar, fonlar ve benzerimali varlıklar
64.30.01 Trustlar, fonlar ve benzerimali varlıklar Az Tehlikeli
64.9 Diğer finansal hizmetfaaliyetleri (Sigorta ve emeklilikfonları hariç)
64.91 Finansal kiralama
64.91.01 Finansal kiralama (finansalleasing) Az Tehlikeli
64.92 Diğer kredi vermefaaliyetleri
64.92.01 Diğer kredi verme faaliyetleri(bankacılık sistemi dışında borçpara verilmesi, uluslararası ticarifinansman, mevduat kabul etmeyenuzmanlaşmış kuruluşlarca konutkredisi verilmesi, rehinkarşılığında borç para verilmesivb.) (ikrazatçılar hariç) Az Tehlikeli
64.92.04 Tarım kredi kooperatiflerininkredi verme faaliyetleri Az Tehlikeli
64.92.07 İkrazatçılarınfaaliyetleri Az Tehlikeli
64.92.08 Tüketici finansmanşirketlerinin faaliyetleri Az Tehlikeli
64.99 Başka yerde sınıflandırılmamışdiğer finansal hizmet faaliyetleri(Sigorta ve emeklilik fonlarıhariç)
64.99.01 Faktöring faaliyetleri Az Tehlikeli
64.99.03 Gayrimenkul yatırımortaklığı Az Tehlikeli
64.99.08 Yatırım bankacılığıfaaliyetleri Az Tehlikeli
64.99.09 Varlık yönetim şirketlerininfaaliyetleri (mülkiyet devriyoluyla yapılanlar) Az Tehlikeli
64.99.10 Menkul kıymet yatırımortaklığı Az Tehlikeli
64.99.90 Başka yerde sınıflandırılmamışdiğer finansal hizmet faaliyetleri(swap, opsiyon ve diğer risktenkorunma sözleşmelerinin yazılması,vb. dahil) Az Tehlikeli
65 Sigorta, reasürans ve emeklilikfonları (Zorunlu sosyal güvenlikhariç)
65.1 Sigorta
65.11 Hayat sigortası
65.11.02 Hayat sigortasıfaaliyetleri Az Tehlikeli
65.12 Hayat sigortası dışındakisigortalar
65.12.13 Hayat sigortası dışındakisigortacılık faaliyetleri (sağlık,yangın, motorlu taşıt, konut,tarım, denizcilik, havacılık, kaza,doğal afet, ulaştırma, nakliyat,para kaybı, borçlanma, malisorumluluk, vb.) Az Tehlikeli
65.2 Reasürans
65.20 Reasürans
65.20.01 Reasürans faaliyetleri (sigortaşirketleri tarafından taahhütedilen sigorta poliçelerine ilişkinriskin üstlenilmesi) Az Tehlikeli
65.3 Emeklilik fonları
65.30 Emeklilik fonları
65.30.01 Emeklilik fonufaaliyetleri Az Tehlikeli
66 Finansal hizmetler ile sigortafaaliyetleri için yardımcıfaaliyetler
66.1 Finansal hizmetler içinyardımcı faaliyetler (Sigorta veemeklilik fonları hariç)
66.11 Finansal piyasalarınyönetimi
66.11.02 Finansal piyasaların yönetimi(emtia sözleşmeleri borsası, menkulkıymetler borsası, hisse senediborsası, vb. yönetimi dahil, kamuotoriteleri tarafından yapılanlarhariç) Az Tehlikeli
66.12 Menkul kıymetler ve emtiasözleşmeleri aracılığı
66.12.01 Menkul kıymetler aracılıkfaaliyetleri (borsa aracılığı vevadeli işlemler dahil) Az Tehlikeli
66.12.04 Döviz bürolarınınfaaliyetleri Az Tehlikeli
66.12.06 Kambiyo hizmetleri (dövizbürolarının faaliyetlerihariç) Az Tehlikeli
66.12.08 Emtia sözleşmeleri aracılıkfaaliyetleri Az Tehlikeli
66.19 Finansal hizmetler içinyardımcı diğer faaliyetler (Sigortave emeklilik fonları hariç)
66.19.02 İpotekli satış ile kredisimsarlığı ve danışmanlığıfaaliyetleri (sigorta ve emeklilikfonları ile esnaf ve sanatkarlarkredi kefalet kooperatiflerininfaaliyetleri hariç) Az Tehlikeli
66.19.03 Finansal danışmanlıkfaaliyetleri Az Tehlikeli
66.19.04 Menkul kıymetlerin operasyon vetakas işlemi faaliyetleri Az Tehlikeli
66.19.05 Yatırım bankacılığına ilişkinyardımcı faaliyetler (birleşme vedevir faaliyeti, işletme finansmanıve risk sermayesi finansmanfaaliyeti, vb.) Az Tehlikeli
66.19.06 Esnaf ve sanatkarlar kredikefalet kooperatiflerinin krediaracılık faaliyetleri ile kredigaranti fonunun faaliyetleri Az Tehlikeli
66.19.07 Yediemin faaliyetleri Az Tehlikeli
66.19.90 Başka yerde sınıflandırılmamışfinansal hizmetlere yardımcı diğerfaaliyetler (finansal işlemlerinoperasyonu ve takas merkezifaaliyetleri, servet yönetimi vesaklama hizmetleri, vb.) Az Tehlikeli
66.2 Sigorta ve emeklilik fonunayardımcı faaliyetler
66.21 Risk ve hasar değerlemesi
66.21.01 Risk ve hasar değerlemesifaaliyetleri (sigorta eksperliğidahil) Az Tehlikeli
66.22 Sigorta acentelerinin vearacılarının faaliyetleri
66.22.01 Sigorta acentelerininfaaliyetleri Az Tehlikeli
66.22.02 Sigorta brokerlarınınfaaliyetleri Az Tehlikeli
66.29 Sigorta ve emeklilik fonunayardımcı diğer faaliyetler
66.29.01 Aktüerya faaliyetleri Az Tehlikeli
66.29.90 Başka yerde sınıflandırılmamışsigorta ve emeklilik fonunayardımcı diğer faaliyetler(kurtarılan sigortalı eşyanınidaresi, vb.) Az Tehlikeli
66.3 Fon yönetimi faaliyetleri
66.30 Fon yönetimi faaliyetleri
66.30.02 Bir ücret veya sözleşmeyedayalı olarak fon yönetimifaaliyetleri (portföy yönetimi,müşterek fonların yönetimi,emeklilik fonlarının yönetimi,vb.) Az Tehlikeli
L GAYRİMENKUL FAALİYETLERİ
68 Gayrimenkul faaliyetleri
68.1 Kendine ait gayrimenkulunalınıp satılması
68.10 Kendine ait gayrimenkulunalınıp satılması
68.10.01 Kendine ait gayrimenkulünalınıp satılması (kendine aitbinalar, devre mülkler, araziler,müstakil evler, vb.) Az Tehlikeli
68.2 Kendine ait veya kiralanangayrimenkulun kiraya verilmesi veyaişletilmesi
68.20 Kendine ait veya kiralanangayrimenkulun kiraya verilmesi veyaişletilmesi
68.20.02 Kendine ait veya kiralanangayrimenkullerin kiraya verilmesiveya leasingi (kendine ait binalar,devre mülkler, araziler, müstakilevler, vb.) Az Tehlikeli
68.3 Bir ücret veya sözleşmetemeline dayalı olan gayrimenkulfaaliyetleri
68.31 Gayrimenkul acenteleri
68.31.01 Gayrimenkul acentelerininfaaliyetleri (gayrimenkulün ücretveya sözleşme temeline dayalıolarak satın alınması, satılması vekiralanmasında aracılık, vb.) Az Tehlikeli
68.31.02 Bir ücret veya sözleşmeyedayalı olarak yapılan gayrimenkuldanışmanlık ve ekspertizfaaliyetleri Az Tehlikeli
68.32 Bir ücret veya sözleşmetemeline dayalı olarakgayrimenkulun yönetilmesi
68.32.02 Bir ücret veya sözleşmeyedayalı olarak yapılan gayrimenkulyönetimi faaliyetleri (siteyöneticiliği, mobil ev alanlarının,müşterek mülkiyetli konutların,devre mülklerin, ikamet amaçlıolmayan mülklerin, vb.yönetimi) Az Tehlikeli
68.32.03 Bir ücret veya sözleşmeyedayalı olarak yapılan kira toplamafaaliyetleri Az Tehlikeli
68.32.04 Bir ücret veya sözleşmeyedayalı olarak yapılan apartmanyöneticiliği Az Tehlikeli
M MESLEKİ, BİLİMSEL VE TEKNİKFAALİYETLER
69 Hukuk ve muhasebefaaliyetleri
69.1 Hukuk faaliyetleri
69.10 Hukuk faaliyetleri
69.10.01 Bilirkişi faaliyetleri (hukukikonularda) Az Tehlikeli
69.10.02 Hukuk müşavirliği Az Tehlikeli
69.10.03 Hukuk danışmanlığı ve temsilfaaliyetleri (avukatlıkfaaliyetleri) Az Tehlikeli
69.10.04 Diğer hukuki hizmetfaaliyetleri (patent, telif hakkıve diğer fikri mülkiyet hakları,varlıkların tasviyesi vb.danışmanlık ve diğer yasalhizmetler) Az Tehlikeli
69.10.07 Noterlik faaliyetleri Az Tehlikeli
69.10.08 Sosyal güvenlik müşavirlerininfaaliyetleri Az Tehlikeli
69.10.09 Hukuki arabuluculuk veuzlaştırma faaliyetleri (işgücü veyönetim arasında, işletmelerarasında veya şahıslar arasındaortaya çıkan anlaşmazlığın çözümüiçin tahkim veya arabuluculukhizmetleri) Az Tehlikeli
69.2 Muhasebe, defter tutma vedenetim faaliyetleri; vergidanışmanlığı
69.20 Muhasebe, defter tutma vedenetim faaliyetleri; vergidanışmanlığı
69.20.01 Mali müşavirlik hizmetleri Az Tehlikeli
69.20.02 Muhasebe ve defter tutmafaaliyetleri Az Tehlikeli
69.20.03 Vergi danışmanlığı ve vergibeyannamesinin hazırlanmasıfaaliyetleri Az Tehlikeli
69.20.04 Yeminli mali müşavirlikfaaliyetleri Az Tehlikeli
69.20.05 Mali denetim faaliyetleri Az Tehlikeli
70 İdare merkezi faaliyetleri;idari danışmanlık faaliyetleri
70.1 İdare merkezi faaliyetleri
70.10 İdare merkezi faaliyetleri
70.10.01 İdare merkezi faaliyetleri(idare merkezi tarafından aynışirket veya girişimin diğerbirimlerine sağlanan yönetimhizmetleri ile bağlı iştirakleriniyöneten holdingler dahil) Az Tehlikeli
70.2 İdari danışmanlıkfaaliyetleri
70.21 Halkla ilişkiler ve iletişimfaaliyetleri
70.21.01 Halkla ilişkiler ve iletişimfaaliyetleri Az Tehlikeli
70.22 İşletme ve diğer idaridanışmanlık faaliyetleri
70.22.02 İşletme ve diğer idaridanışmanlık faaliyetleri (birorganizasyonun stratejik, mali,pazarlama, üretim, iş süreçleri,proje vb. yönetim hizmetleri ileticari marka ve imtiyaz konularındadanışmanlık) Az Tehlikeli
70.22.03 İnsan kaynakları yönetimdanışmanlığı faaliyetleri Az Tehlikeli
71 Mimarlık ve mühendislikfaaliyetleri; teknik test ve analizfaaliyetleri
71.1 Mimarlık ve mühendislikfaaliyetleri ve ilgili teknikdanışmanlık
71.11 Mimarlık faaliyetleri
71.11.01 Mimarlık faaliyetleri ve mimaridanışmanlık faaliyetleri Az Tehlikeli
71.11.02 Şehir ve bölge planlamafaaliyetleri (nazım imar planı,vaziyet planı vb. dahil) Az Tehlikeli
71.11.04 Peyzaj mimarisi faaliyetleri vepeyzaj konusunda mimari danışmanlıkfaaliyetleri Az Tehlikeli
71.12 Mühendislik faaliyetleri veilgili teknik danışmanlık
71.12.01 Yer yüzeyinin araştırılması veharita yapımına yönelik mühendislikfaaliyetleri (jeodezik,fotogrametrik ve hidrografik ölçümyapma, topografya hizmetleri ileyol, kadastro, topoğrafik, vb.haritaların hazırlanması) Az Tehlikeli
71.12.03 Bina projelerine yönelikmühendislik ve danışmanlıkfaaliyetleri Az Tehlikeli
71.12.04 Jeolojik, jeofizik ve ilgiliaraştırma ve danışmanlıkhizmetlerine yönelik mühendislikfaaliyetleri (maden yatağı, yeraltı toprak oluşumu, vb. hizmetler)(petrol ve doğalgaz için olanlarhariç) Az Tehlikeli
71.12.05 Petrol ve doğalgaz çıkarımprojelerine yönelik mühendislik vedanışmanlık faaliyetleri Az Tehlikeli
71.12.06 Ulaştırma projelerine yönelikmühendislik ve danışmanlıkfaaliyetleri (karayolu, köprü,tünel, demir yolları, havaalanı,petrol ve gaz taşımacılıkprojeleri, liman vb.) Az Tehlikeli
71.12.07 Su, kanalizasyon ve drenajprojelerine yönelik mühendislik vedanışmanlık faaliyetleri (içme suyudağıtım sistemleri, pompaistasyonları, yağmur suyu yönetimsistemleri, atık suların toplanmasıvb. projeler) Az Tehlikeli
71.12.08 Sanayi ve imalat projelerineyönelik mühendislik ve danışmanlıkfaaliyetleri (haddehaneler,farineriler, ulaşım araçları,sanayi makineleri, vb.) Az Tehlikeli
71.12.09 Enerji projelerine yönelikmühendislik ve danışmanlıkfaaliyetleri (kömür, petrol ve gazgibi enerji yakıtları kullananlarile nükleer, su, güneş, rüzgar vediğer enerjiler için santrallere veenerji iletim ve dağıtım hatlarınayönelik hizmetler) Az Tehlikeli
71.12.10 Mühendislik danışmanlıkhizmetleri (bir projeyle bağlantılıolarak yapılanlar hariç) Az Tehlikeli
71.12.11 Yapı denetim kuruluşları (asınıfı) Az Tehlikeli
71.12.12 Yapı denetim kuruluşları (bsınıfı) Az Tehlikeli
71.12.13 Yapı denetim kuruluşları (csınıfı) Az Tehlikeli
71.12.90 Diğer projelere yönelikmühendislik ve danışmanlıkfaaliyetleri (telekomünikasyon veyayıncılık projeleri, doğalgaz vebuhar dağıtım projeleri vediğerleri ile inşaat projelerininyönetimi dahil)) Az Tehlikeli
71.2 Teknik test ve analizfaaliyetleri
71.20 Teknik test ve analizfaaliyetleri
71.20.05 Kara yolu taşıma araçlarınınteknik muayene faaliyetleri(otomobil, motosiklet, otobüs,pikap, kamyon ve diğer kara yoluaraçlarının periyodik teknikmuayene hizmetleri) Tehlikeli
71.20.07 Bileşim ve saflık konularındateknik test ve analiz faaliyetleri(atık, yakıt, metal, mineral vekimyasallar gibi maddelerinbiyolojik ve kimyasal özellikleriile mikrobiyoloji, biyokimya vb.ilgili alanlarda test ve analizfaaliyetleri) Tehlikeli
71.20.08 Su, hava vb. kirliliğikonularında teknik test ve analizfaaliyetleri Tehlikeli
71.20.09 Fiziksel özellikler konusundateknik test ve analiz faaliyetleri(metal, plastik, tekstil, beton vediğer maddelerin mukavemeti,esnekliği, iletkenliği gibifiziksel özellikleri ile gerilim,sertlik, darbe direnci vb. test veanaliz faaliyetleri) Tehlikeli
71.20.10 Ürünlerin ruhsatlandırılmasıfaaliyetleri (tüketim malları,motorlu kara taşıtları, uçaklar,ilaçlar vb.) Az Tehlikeli
71.20.11 Gıda konusunda teknik test veanaliz faaliyetleri (veterinerdenetimi de dahil olmak üzere gıdahijyeni alanında teknik testfaaliyetleri) Tehlikeli
71.20.12 Entegre mekanik ve elektriksistemleri konusunda teknik test veanaliz faaliyetleri (mekanik veelektrik bileşenli makine, motor,otomobil, alet, cihaz, iletişimekipmanı vb. ekipmanların test veanaliz faaliyetleri) Tehlikeli
71.20.13 Polis laboratuvarlarının analizfaaliyetleri Tehlikeli
71.20.90 Diğer teknik test ve analizfaaliyetleri (makine parça veyapıların kusurlarını belirlemekiçin radyografik, manyetik veultrasonik testleri, sanatsalçalışmaların doğruluğununkanıtlanması, kaynaklarınradyolojik muayenesi vediğerleri) Çok Tehlikeli
72 Bilimsel araştırma vegeliştirme faaliyetleri
72.1 Doğal bilimler ve mühendislikleilgili araştırma ve deneyselgeliştirme faaliyetleri
72.11 Biyoteknolojiyle ilgiliaraştırma ve deneysel geliştirmefaaliyetleri
72.11.01 Biyoteknolojiyle ilgiliaraştırma ve deneysel geliştirmefaaliyetleri Tehlikeli
72.19 Doğal bilimler ve mühendislikleilgili diğer araştırma ve deneyselgeliştirme faaliyetleri
72.19.01 Doğal bilimler ve mühendislikleilgili diğer araştırma ve deneyselgeliştirme faaliyetleri (tarımsalaraştırmalar dahil) Tehlikeli
72.2 Sosyal bilimlerle ve beşeribilimlerle ilgili araştırma vedeneysel geliştirmefaaliyetleri
72.20 Sosyal bilimlerle ve beşeribilimlerle ilgili araştırma vedeneysel geliştirmefaaliyetleri
72.20.01 Sosyal bilimlerle ve beşeribilimlerle ilgili araştırma vedeneysel geliştirmefaaliyetleri Az Tehlikeli
73 Reklamcılık ve piyasaaraştırması
73.1 Reklamcılık
73.11 Reklam ajanslarınınfaaliyetleri
73.11.01 Reklam ajanslarınınfaaliyetleri (kullanılacak medyanınseçimi, reklamın tasarımı, sözlerinyazılması, reklam filmleri içinsenaryonun yazımı, satışnoktalarında reklam ürünleriningösterimi ve sunumu vb.) Az Tehlikeli
73.11.03 Reklam araç ve eşantiyonlarındağıtımı ve teslimifaaliyetleri Az Tehlikeli
73.12 Çeşitli medya reklamları içinalan ve zamanın bir ücret veyasözleşmeye dayalı olaraksatışı
73.12.02 Çeşitli medya reklamları içinalan ve zamanın bir ücret veyasözleşmeye dayalı olarak satışı(ilan tahtası, billboard, bina,araç vb. üzerinden reklamalanlarının ve zamanlarının satışıdahil) Az Tehlikeli
73.2 Piyasa ve kamuoyu araştırmafaaliyetleri
73.20 Piyasa ve kamuoyu araştırmafaaliyetleri
73.20.03 Piyasa ve kamuoyu araştırmafaaliyetleri (anket yapma, kamuoyuyoklamaları vb.) Az Tehlikeli
74 Diğer mesleki, bilimsel veteknik faaliyetler
74.1 Uzmanlaşmış tasarımfaaliyetleri
74.10 Uzmanlaşmış tasarımfaaliyetleri
74.10.01 İç mimarların faaliyetleri (içdekorasyon dahil) Az Tehlikeli
74.10.02 Diğer uzmanlaşmış tasarımfaaliyetleri (tekstil, giyim,ayakkabı gibi kişisel eşyalar ve eveşyaları tasarımı ile endüstriyeltasarım dahil, iç mimarların veuzmanlaşmış grafik tasarımcılarınfaaliyetleri hariç) Az Tehlikeli
74.10.03 Uzmanlaşmış grafiktasarımcılarının faaliyetleri(marka ve alametifarika tasarımıdahil) Az Tehlikeli
74.2 Fotoğrafçılık faaliyetleri
74.20 Fotoğrafçılık faaliyetleri
74.20.22 Tüketicilere yönelikfotoğrafçılık faaliyetleri(pasaport, okul, düğün vb. içinvesikalık ve portre fotoğrafçılığıvb.) Az Tehlikeli
74.20.25 Hava ve su altı fotoğrafçılığıfaaliyetleri Çok Tehlikeli
74.20.26 Reklamcılık ile ilgilifotoğrafçılık faaliyetleri (reklamgörselleri, broşür, gazete ilanı,katalog vb. için ticari ürünlerin,moda kıyafetlerinin, makinelerin,binaların, kişilerin, vb.ninfotoğraflarının çekilmesi) Az Tehlikeli
74.20.27 Etkinlik fotoğrafçılığı veetkinliklerin videoya çekilmesifaaliyetleri (düğün, mezuniyet,konferans, resepsiyon, modagösterileri, spor ve diğer ilgiçekici olayların fotoğraflanmasıveya videoya çekilmesi) Az Tehlikeli
74.20.28 Bağımsız foto muhabirlerininfaaliyetleri Az Tehlikeli
74.20.29 Fotoğraf işleme faaliyetleri(negatiflerin tab edilmesi veresimlerin basılması, negatiflerinveya slaytların çoğaltılması,fotografik slaytların hazırlanması,filmlerin kopyalanması vb.) Az Tehlikeli
74.20.90 Diğer fotoğrafçılıkfaaliyetleri (fotomikrografi,mikrofilm hizmetleri, fotoğraflarınrestorasyonu ve rötuşlama,vb.) Az Tehlikeli
74.3 Tercüme ve sözlü tercümefaaliyetleri
74.30 Tercüme ve sözlü tercümefaaliyetleri
74.30.12 Tercüme ve sözlü tercümefaaliyetleri (yeminli tercümebüroları, mütercimlik vetercümanlık faaliyetleri vb.dahil) Az Tehlikeli
74.9 Başka yerde sınıflandırılmamışdiğer mesleki, bilimsel ve teknikfaaliyetler
74.90 Başka yerde sınıflandırılmamışdiğer mesleki, bilimsel ve teknikfaaliyetler
74.90.01 Ekspertiz faaliyetleri (antikaeşyalar, mücevherler vb. içinekspertiz hizmetleri) (gayrimenkulve sigorta için olan ekspertizfaaliyetleri hariç) Az Tehlikeli
74.90.02 İşyeri komisyonculuğufaaliyetleri (küçük ve orta ölçekliişletmelerin alım ve satımınındüzenlenmesi vb.) Az Tehlikeli
74.90.03 Fatura denetimi ve navlun oranıbilgi faaliyetleri Az Tehlikeli
74.90.04 Hava tahmini ve meteorolojikfaaliyetler Az Tehlikeli
74.90.05 Sanatçı, sporcu, şovmen, mankenve diğerleri için ajansların vemenajerlerin faaliyetleri Az Tehlikeli
74.90.90 Başka yerde sınıflandırılmamışdiğer mesleki, bilimsel ve teknikfaaliyetler (çevre danışmanlığı,güvenlik danışmanlığı,matematikçiler, istatistikçiler,agronomlar vb. tarafından verilendanışmanlık hizmetleri, patentaracılığı vb.) Az Tehlikeli
75 Veterinerlik hizmetleri
75.0 Veterinerlik hizmetleri
75.00 Veterinerlik hizmetleri
75.00.02 Hayvan hastanelerininfaaliyetleri (evcil hayvanlar içinambulans faaliyetleri dahil) Tehlikeli
75.00.04 Veterinerlik hizmetleri (hayvanhastanelerinde verilen hizmetlerhariç) Tehlikeli
N İDARİ VE DESTEK HİZMETFAALİYETLERİ
77 Kiralama ve leasingfaaliyetleri
77.1 Motorlu kara taşıtlarınınkiralanması ve leasingi
77.11 Motorlu hafif kara taşıtlarınınve arabaların kiralanması veleasingi
77.11.01 Motorlu hafif kara taşıtlarınınve arabaların sürücüsüz olarakkiralanması ve leasingi (3.5 tondandaha az olan otomobil, kamyonet,vb. dahil, motosiklet hariç) Az Tehlikeli
77.12 Kamyonların kiralanması veleasingi
77.12.01 Motorlu ağır kara taşıtlarınınsürücüsüz olarak kiralanması veleasingi (3.5 tondan daha fazlaolan kamyon, treyler (römork), vb.)(karavan ve tarımsal makine veekipmanlar ile inşaat makine veekipmanlarının kiralanması veleasingi hariç) Az Tehlikeli
77.2 Kişisel eşyaların ve eveşyalarının kiralanması veleasingi
77.21 Eğlence ve spor eşyalarınınkiralanması ve leasingi
77.21.01 Eğlence ve spor amaçlı olarakat, midilli, deve vb. kiralanmasıve leasingi Az Tehlikeli
77.21.02 Bisikletlerin kiralanması veleasingi Az Tehlikeli
77.21.04 Eğlence ve spor amaçlı sandal,tekne, kano, yelkenli, vb.ninmürettebatsız olarak kiralanması veleasingi Az Tehlikeli
77.21.90 Diğer eğlence ve sporeşyalarının kiralanması ve leasingi(kar kayağı, buz pateni, planör,delta kanat, sörf tahtası, sukayağı, golf sopası, kampmalzemesi, plaj sandalyesi veşemsiyesi, saha oyunları içinmalzeme, oyuncak vb.) Az Tehlikeli
77.22 Video kasetlerin ve disklerinkiralanması
77.22.01 Video kasetlerinin, plaklarınve disklerin kiralanması Az Tehlikeli
77.29 Başka yerde sınıflandırılmamışdiğer kişisel ve ev eşyalarınınkiralanması ve leasingi
77.29.01 Gelinlik, kostüm, tekstil,giyim eşyası, ayakkabı vemücevherlerin kiralanması Az Tehlikeli
77.29.02 Bys. diğer kişisel ve eveşyalarının kiralanması ve leasingi(mobilya, elektrikli ve elektronikalet, kitap, TV, kamera, bitki, vb.dahil, müzik aleti, giyim eşyası,mücevher, vb. ile video kasetler,büro mobilyaları, eğlence ve sporekipmanları hariç) Az Tehlikeli
77.29.03 Müzik aletlerinin kiralanmasıve leasingi Az Tehlikeli
77.3 Diğer makine, ekipman ve maddimalların kiralanması veleasingi
77.31 Tarımsal makine ve ekipmanlarınkiralanması ve leasingi
77.31.01 Tarımsal makine ve ekipmanlarınoperatörsüz olarak kiralanması veleasingi (tarımsal traktör, pulluk,biçerdöver, süt sağma makinesi,arıcılık makinesi, vb. dahil, çimbiçme makineleri hariç) Az Tehlikeli
77.32 Bina ve bina dışı inşaatlardakullanılan makine ve ekipmanlarınkiralanması ve leasingi
77.32.01 Bina ve bina dışı inşaatlardakullanılan makine ve ekipmanlarınoperatörsüz olarak kiralanması veleasingi (vinç kamyonu, inşaat vetoprak taşımak için traktör, yolgreyderi ve silindiri, buldozer,yapı iskelesi, şantiye kulübesi,vb.) (kurma/sökme hariç) Az Tehlikeli
77.33 Büro makine ve ekipmanlarının(bilgisayarlar dahil) kiralanmasıve leasingi
77.33.01 Büro makine ve ekipmanlarınınoperatörsüz olarak kiralanması veleasingi (kasa, fotokopi makinesi,daktilo, yazar kasa, vb. dahil,bilgisayarlar ve çevre birimleri,telefon ve faks makineleri ve büromobilyaları hariç) Az Tehlikeli
77.33.02 Büro mobilyalarının kiralanmasıve leasingi (büro sandalyesi vemasasının kiralanması dahil) Az Tehlikeli
77.33.03 Bilgisayar ve çevrebirimlerinin operatörsüz olarakkiralanması ve leasingi (elektronikveri işlemci, merkezi işlem birimi,çevre birimleri, manyetik veyaoptik okuyucular, vb.) Az Tehlikeli
77.34 Su yolu taşımacılığıekipmanının kiralanması veleasingi
77.34.01 Su yolu taşımacılığıekipmanlarının operatörsüz olarakkiralanması ve leasingi (yolcu veyük taşımacılığı için ticari tekneve gemiler dahil, gezinti teknelerihariç) Az Tehlikeli
77.35 Hava taşımacılığı araçlarınınkiralanması ve leasingi /td>
77.35.01 Hava taşımacılığı araçlarınınoperatörsüz olarak kiralanması veleasingi (uçak, helikopter, balon,vb.) Az Tehlikeli
77.39 Başka yerde sınıflandırılmamışdiğer makine, ekipman ve eşyalarınkiralanması ve leasingi
77.39.01 Demir yolu ulaşımekipmanlarının operatörsüz olarakkiralanması ve leasingi (lokomotifve diğer vagonlar, metro vagonları,hafif demir yolu ekipmanları,tramvay, vb.) Az Tehlikeli
77.39.02 Konteynerlerin kiralanması veyaleasingi (konaklama ve büro amaçlıolanlar, birden çok taşımatürlerine uygun olanlar vediğerleri) Az Tehlikeli
77.39.03 Motosiklet, karavan ve kampgereçlerinin operatörsüz olarakkiralanması veya leasingi Az Tehlikeli
77.39.04 Maden ve petrol sahasındakullanılan ekipmanların operatörsüzolarak kiralanması veyaleasingi Az Tehlikeli
77.39.05 Motorlar ve türbinlerinoperatörsüz olarak kiralanması veyaleasingi Az Tehlikeli
77.39.06 Mesleki ve bilimsel amaçlıölçüm ve kontrol ekipmanlarınınoperatörsüz olarak kiralanması veyaleasingi (tıbbi cihaz veekipmanların kiralanmasıdahil) Az Tehlikeli
77.39.07 Ticari radyo, televizyon vetelekomünikasyon ekipmanları,sinema filmi yapım ekipmanları,telefon, faks makinesi, çağrıcihazı ve hücresel telefonlarınoperatörsüz olarak kiralanması veyaleasingi (kişisel ve ev eşyası olanTV, radyo, kameralar hariç) Az Tehlikeli
77.39.08 Madeni para ile çalışan kumarmakinelerinin operatörsüz olarakkiralanması veya leasingi Az Tehlikeli
77.39.10 Takım tezgahlarının ve diğerticari ve endüstriyel makinelerinoperatörsüz olarak kiralanması veyaleasingi Az Tehlikeli
77.39.11 Tiyatro dekor ve malzemelerininkiralanması (kostümler hariç) Az Tehlikeli
77.39.13 Hayvanların kiralanmasıfaaliyetleri (hayvan sürüleri,yarış atları vb.) (eğlence ve sporamaçlı olanlar hariç) Az Tehlikeli
77.39.90 Başka yerde sınıflandırılmamışgenellikle endüstride sermaye malıolarak kullanılan diğer makine,ekipman ve eşyaların operatörsüzolarak kiralanması ve leasingi(sergi malzemesi, palet, vb. dahil,kişisel eşyalar ve ev eşyalarıhariç) Az Tehlikeli
77.4 Fikri mülkiyet haklarının vebenzer ürünlerin leasingi (Telifhakkı alınmış olan çalışmalarhariç)
77.40 Fikri mülkiyet haklarının vebenzer ürünlerin leasingi (Telifhakkı alınmış olan çalışmalarhariç)
77.40.01 Fikri mülkiyet haklarının vebenzer ürünlerin leasingi (patentlivarlıklar, markalar, imtiyazsözleşmeleri, vb. dahil, telifhakkı alınmış olan çalışmalarhariç) Az Tehlikeli
78 İstihdam faaliyetleri
78.1 İş bulma acentelerininfaaliyetleri
78.10 İş bulma acentelerininfaaliyetleri
78.10.01 İş bulma acentelerininfaaliyetleri (işe girecek kişilerinseçimi ve yerleştirilmesifaaliyetleri dahil) Az Tehlikeli
78.10.04 Oyuncu seçme ajansları vebürolarının faaliyetleri (tiyatrorol dağıtım ajansları vb.) Az Tehlikeli
78.2 Geçici iş bulma acentelerininfaaliyetleri
78.20 Geçici iş bulma acentelerininfaaliyetleri
78.20.01 Geçici iş bulma acentelerininfaaliyetleri Az Tehlikeli
78.3 Diğer insan kaynaklarınınsağlanması
78.30 Diğer insan kaynaklarınınsağlanması
78.30.03 Diğer insan kaynaklarınınsağlanması (uzun süreli çalışmadönemleri için personel sağlanmasıhizmetleri) Az Tehlikeli
79 Seyahat acentesi, tur operatörüve diğer rezervasyon hizmetleri veilgili faaliyetler
79.1 Seyahat acentesi ve turoperatörlerinin faaliyetleri
79.11 Seyahat acentesifaaliyetleri
79.11.01 Seyahat acentesi faaliyetleri(hava yolu, deniz yolu, kara yolu,demir yolu ulaşımı için biletrezervasyon işlemleri ve biletsatışı, seyahat, tur, ulaşım vekonaklama hizmetlerinin toptan veyaperakende satışı, vb.) Az Tehlikeli
79.12 Tur operatörü faaliyetleri
79.12.01 Tur operatörü faaliyetleri(turların düzenlenmesi) Az Tehlikeli
79.9 Diğer rezervasyon hizmetleri veilgili faaliyetler
79.90 Diğer rezervasyon hizmetleri veilgili faaliyetler
79.90.01 Turist rehberliği veziyaretçiler için danışmanlıkfaaliyetleri (gezilerle ilgilibilgi sağlanması) Az Tehlikeli
79.90.02 Spor, müzik, tiyatro ve diğereğlence etkinlikleri için yerayırma (rezervasyon) ve biletsatılması faaliyeti Az Tehlikeli
79.90.90 Bys. diğer rezervasyonhizmetleri ve ilgili faaliyetler(devre mülk takas faaliyetleri,turizmi arttırma faaliyetleri, vb.dahil, seyahat acentelerinin ve turoperatörlerinin faaliyetlerihariç) Az Tehlikeli
80 Güvenlik ve soruşturmafaaliyetleri
80.1 Özel güvenlik faaliyetleri
80.10 Özel güvenlik faaliyetleri
80.10.05 Özel güvenlik faaliyetleri(şirketlerce zırhlı araç sağlama,para, vb. değerli şeylerintoplanması ve dağıtımı, koruma vedevriye, araç park kontrol, korumaköpeği eğitimi, parmak izi tespitivb. dahil, kamu güvenliğihariç) Tehlikeli
80.2 Güvenlik sistemleri hizmetfaaliyetleri
80.20 Güvenlik sistemleri hizmetfaaliyetleri
80.20.01 Güvenlik sistemleri hizmetfaaliyetleri (hırsız ve yangınalarmı, elektronik kasa gibigüvenlik sistemlerinin kontrolü,kurulumu, bakımı, alınan alarmsinyali ile sistemin doğrulanmasıve polis, itfaiye gibi birimlerinharekete geçirilmesi) Az Tehlikeli
80.3 Soruşturma faaliyetleri
80.30 Soruşturma faaliyetleri
80.30.04 Soruşturma faaliyetleri (özeldedektiflik faaliyetleridahil) Az Tehlikeli
80.30.05 İmza ve el yazısı tespitfaaliyetleri Az Tehlikeli
81 Binalar ile ilgili hizmetler veçevre düzenlemesi faaliyetleri
81.1 Tesis bünyesindeki kombinedestek hizmetleri
81.10 Tesis bünyesindeki kombinedestek hizmetleri
81.10.01 Tesis bünyesindeki kombinedestek hizmetleri (işletme veyatesis bünyesinde temizlik, bakım,çöplerin bertarafı, koruma vegüvenlik, posta dağıtımı,çamaşırhane, resepsiyon vb.yardımcı hizmet ve görevlerinbirden fazlasının sağlanması) Tehlikeli
81.2 Temizlik faaliyetleri
81.21 Binaların genel temizliği
81.21.01 Binaların genel temizliği(daire, apartman, büro, fabrika,kurum, mağaza vb. her türlü binanıngenel temizliği dahil, pencere,baca, sanayi makinesi, vb.uzmanlaşmış temizlik faaliyetlerihariç) Az Tehlikeli
81.22 Diğer bina ve endüstriyeltemizlik faaliyetleri
81.22.01 Diğer bina ve endüstriyeltemizlik faaliyetleri (binalarındışı, pencere, baca, fırın,kalorifer kazanı, havalandırmakanalı, egzoz ünitesi, sanayimakinesi temizliği vb. uzmanlaşmıştemizlik faaliyetleri) Çok Tehlikeli
81.29 Diğer temizlikfaaliyetleri
81.29.02 Yol ve pistlerdeki kar ve buzunkaldırılması (kum, tuz dökülmesidahil) Tehlikeli
81.29.03 Park ve caddelerin süpürülerekyıkanması, temizlenmesifaaliyetleri Az Tehlikeli
81.29.04 Böceklerin, kemirgenlerin vediğer zararlıların imhası ve haşerekontrol faaliyetleri (tarımsalzararlılarla mücadele hariç) Çok Tehlikeli
81.29.90 Diğer temizlik faaliyetleri(yüzme havuzları, tren, otobüs,uçak, tanker, plaj ve şişelerintemizlenmesi ile dezenfektefaaliyetleri dahil, oto yıkamahariç) Çok Tehlikeli
81.3 Çevre düzenlemesi ve bakımıfaaliyetleri
81.30 Çevre düzenlemesi ve bakımıfaaliyetleri
81.30.01 Gürültü, rüzgar, erozyon,yansıma, vb.ne karşı koruyucubitkilerin dikimi ve bakımı Az Tehlikeli
81.30.05 Spor alanları (futbol sahaları,golf alanları gibi), oyun alanları,güneş banyosu için çimenler vediğer eğlence parkları için yeşilalanların dikimi ve bakımıfaaliyetleri Az Tehlikeli
81.30.90 Diğer çevre düzenlemesi vebakımı ile peyzaj projelerininuygulanması faaliyetleri (park,bahçe ve yeşil alanların dikimi,bakım ve onarımı) Az Tehlikeli
82 Büro yönetimi, büro destek veiş destek faaliyetleri
82.1 Büro yönetimi ve destekfaaliyetleri
82.11 Kombine büro yönetim hizmetifaaliyetleri
82.11.01 Kombine büro yönetim hizmetifaaliyetleri (bir ücret veyasözleşme temelinde sekreterlik,finansal planlama, faturalama vekayıt tutulması, personel ve postavb. hizmetlerin kombinasyonununsağlanması) Az Tehlikeli
82.19 Fotokopi çekme, dokümanhazırlama ve diğer uzmanlaşmış bürodestek hizmetleri
82.19.01 Fotokopi, doküman hazırlama vediğer uzmanlaşmış büro destekhizmetleri (doküman hazırlama,daktilo, sekreterya, fotokopi,ozalit çekimi, mektup, çoğaltmavb.) (adres derleme ve postalamahizmetleri dahil, tez yazımıhariç) Az Tehlikeli
82.19.03 Tez vb. yazım bürolarınınfaaliyetleri Az Tehlikeli
82.2 Çağrı merkezlerininfaaliyetleri
82.20 Çağrı merkezlerininfaaliyetleri
82.20.01 Çağrı merkezlerininfaaliyetleri Tehlikeli
82.3 Kongre ve ticari gösteriorganizasyonu
82.30 Kongre ve ticari gösteriorganizasyonu
82.30.02 Gösteri, kongre, konferans,ticari fuar, vb. etkinliklerinorganizasyonu faaliyetleri Az Tehlikeli
82.9 Başka yerde sınıflandırılmamışişletme destek hizmetfaaliyetleri
82.91 Tahsilat daireleri ve kredikayıt bürolarının faaliyetleri
82.91.01 Tahsilat büroları ve kredikayıt bürolarının faaliyetleri(telefon, elektrik, su, vb. faturave borç toplama, kişilerin veyaişletmelerin kredi veya çalışmageçmişleri hakkında bilgi toplama,vb.) Az Tehlikeli
82.92 Paketleme faaliyetleri
82.92.01 Tehlikesiz ürünleri paketlemefaaliyetleri (bir ücret veyasözleşme temelinde yiyecek, içecekdahil sıvıların şişelenmesi, katımaddelerin paketlenmesi,etiketleme, damgalama, marka basma,paket ambalajlama, vb.) Tehlikeli
82.92.05 Tehlikeli ürünleri paketlemefaaliyetleri (bir ücret veyasözleşme temelinde sıvılarınşişelenmesi, katı maddelerinpaketlenmesi, etiketleme,damgalama, marka basma, paketambalajlama, vb.) Çok Tehlikeli
82.99 Başka yerde sınıflandırılmamışdiğer işletme destek hizmetfaaliyetleri
82.99.02 Elektrik, gaz, su ve ısınmasayaçlarını okuma ve faturalamafaaliyetleri Az Tehlikeli
82.99.04 Trafik müşavirliği Az Tehlikeli
82.99.05 Harfi harfine raporlama vestenografi kayıt faaliyetleri Az Tehlikeli
82.99.06 Telefona dayalı destekfaaliyetleri (telefon cevaplama veuyandırma hizmetleri) Az Tehlikeli
82.99.07 Barkodlama faaliyetleri(paketleme faaliyetidışındakiler) Az Tehlikeli
82.99.08 İş takipçiliği faaliyeti Az Tehlikeli
82.99.90 Başka yerde sınıflandırılmamışdiğer iş destek hizmet faaliyetleri(borcu ödenmeyen malların gerialınması, indirim kuponu dağıtımhizmetleri, park sayacındanparaların toplanması ve diğer işdestek hizmetleri) Az Tehlikeli
O KAMU YÖNETİMİ VE SAVUNMA;ZORUNLU SOSYAL GÜVENLİK
84 Kamu yönetimi ve savunma;zorunlu sosyal güvenlik
84.1 Ülke yönetimi ve toplumunekonomik ve sosyal politikalarınınyönetimi
84.11 Genel kamu idaresifaaliyetleri
84.11.41 Belediyelerin kamu yönetimihizmetleri Az Tehlikeli
84.11.42 Ekonomik ve sosyal planlama ileistatistik ile ilgili kamu yönetimihizmetleri Az Tehlikeli
84.11.43 Finansal, mali ve denetim ileilgili kamu yönetimi hizmetleri(defterdarlık, mal müdürlükleri,vergi daireleri, Sayıştay, kamuborç ve fonlarının yönetimidahil) Az Tehlikeli
84.11.44 Genel personel işleri ileilgili kamu yönetimihizmetleri Az Tehlikeli
84.11.45 Gümrüklerle ilgili kamuyönetimi hizmetleri Az Tehlikeli
84.11.46 Muhtarların faaliyetleri Az Tehlikeli
84.11.47 Valiliklerin vekaymakamlıkların kamu yönetimihizmetleri (il ve ilçe özelidarelerinin faaliyetleridahil) Az Tehlikeli
84.11.48 Yasama ve yürütmehizmetleri Az Tehlikeli
84.11.90 Kamu için diğer destekleyicikamu yönetimi hizmetleri (merkezikamu ihale ve tedarik hizmetleriile haritacılık vb.) Az Tehlikeli
84.12 Sağlık, eğitim, kültürelhizmetler ve diğer sosyalhizmetleri sağlayan kuruluşlarınfaaliyetlerinin düzenlenmesi(Sosyal güvenlik hariç)
84.12.11 Eğitime ilişkin kamu yönetimihizmetleri Az Tehlikeli
84.12.12 İskan ve toplum refahınailişkin kamu yönetimi hizmetleri(su temini ve çevre korumaprogramları dahil) Az Tehlikeli
84.12.13 Sağlığa ve sosyal hizmetlereilişkin kamu yönetimihizmetleri Az Tehlikeli
84.12.14 Spor, dinlence, kültür ve dineilişkin kamu yönetimihizmetleri Az Tehlikeli
84.13 İş etkinliğinin artırılmasınayönelik katkı ve düzenlemefaaliyetleri
84.13.11 Çok amaçlı geliştirme projeleriile ilgili kamu yönetimi hizmetleri(bölgesel kalkınma projeleridahil) Az Tehlikeli
84.13.12 Genel ekonomik, ticari veişgücü ile ilgili kamu yönetimihizmetleri (genel ekonomipolitikalarının oluşturulması,teşvik faaliyetleri, patent işleri,genel istihdam politikaları,meteoroloji işleri, istihdamvb.) Az Tehlikeli
84.13.13 Madencilik, doğal kaynaklar,imalat ve inşaat ile ilgili kamuyönetimi hizmetleri Az Tehlikeli
84.13.14 Tarım, ormancılık, balıkçılıkve avcılıkla ilgili kamu yönetimihizmetleri Az Tehlikeli
84.13.15 Ticaret, otelcilik velokantacılık ile ilgili kamuyönetimi hizmetleri Az Tehlikeli
84.13.16 Turizm ile ilgili kamu yönetimihizmetleri Az Tehlikeli
84.13.17 Ulaştırma ve iletişim ileilgili kamu yönetimihizmetleri Az Tehlikeli
84.13.18 Yakıt ve enerji ile ilgili kamuyönetimi hizmetleri (enerjibakanlığı, vb.) Az Tehlikeli
84.2 Bir bütün olarak toplumahizmetlerin sağlanması
84.21 Dışişleri ile ilgilihizmetler
84.21.05 Dış işleri ile ilgili kamuyönetimi hizmetleri (yurt dışıdiplomatik hizmetler ve konsoloslukhizmetleri hariç) Az Tehlikeli
84.21.06 Yurt dışı diplomatik hizmetlerve konsolosluk hizmetleri (yabancıkonsolosluklar hariç) Az Tehlikeli
84.22 Savunma faaliyetleri
84.22.05 Askeri savunma hizmetleri(silahlı kuvvetler ve savunma ileilgili idari hizmetler) Tehlikeli
84.22.06 Sivil savunma hizmetleri Az Tehlikeli
84.23 Adalet ve yargı organlarınınfaaliyetleri
84.23.04 Adalet ve yargı organlarınınfaaliyetleri (icra müdürlükleri vb.dahil, ceza infaz kurumlarının vemahkemelerin faaliyetlerihariç) Az Tehlikeli
84.23.05 Ceza infaz ve tutuk evlerininfaaliyetleri (eğitim verehabilitasyon faaliyetlerihariç) Tehlikeli
84.23.06 Mahkemelerin faaliyetleri(yüksek yargı organları dahil) Az Tehlikeli
84.24 Kamu düzeni ve güvenliği ileilgili faaliyetler
84.24.01 Kamu düzeni ve güvenliği ileilgili faaliyetler (polishizmetleri, sahil güvenlikvb.) Tehlikeli
84.25 İtfaiye hizmetleri
84.25.01 İtfaiye hizmetleri (havataşıtlarıyla yapılanlar ile ormanyangınlarıyla mücadele ve korumafaaliyetleri hariç) Çok Tehlikeli
84.25.02 Hava taşıtları yoluyla yapılanitfaiye hizmetleri (ormanyangınlarıyla mücadele ve korumafaaliyetleri hariç) Çok Tehlikeli
84.3 Zorunlu sosyal güvenlikfaaliyetleri
84.30 Zorunlu sosyal güvenlikfaaliyetleri
84.30.01 Zorunlu sosyal güvenlikfaaliyetleri Az Tehlikeli
P EĞİTİM
85 Eğitim
85.1 Okul öncesi eğitim
85.10 Okul öncesi eğitim
85.10.01 Kamu kurumları tarafındanverilen okul öncesi eğitimfaaliyeti (okula yönelik eğitimverilmeyen gündüz bakım (kreş)faaliyetleri hariç) Az Tehlikeli
85.10.02 Özel öğretim kurumlarıtarafından verilen okul öncesieğitim faaliyeti (okula yönelikeğitim verilmeyen gündüz bakım(kreş) faaliyetleri hariç) Az Tehlikeli
85.2 İlköğretim
85.20 İlköğretim
85.20.06 Kamu kurumları tarafındanverilen fiziksel veya zihinselengellilere yönelik ilköğretimfaaliyeti Az Tehlikeli
85.20.07 Kamu kurumları tarafındanverilen ilköğretim faaliyeti(yetişkinlere yönelik okuma yazmaprogramlarının verilmesi dahil,engelliler için verilen eğitimhariç) Az Tehlikeli
85.20.08 Özel öğretim kurumlarıtarafından verilen fiziksel veyazihinsel engellilere yönelikilköğretim faaliyeti Az Tehlikeli
85.20.09 Özel öğretim kurumlarıtarafından verilen ilköğretimfaaliyeti (yetişkinlere yönelikokuma yazma programlarınınverilmesi dahil, engelliler içinverilen eğitim hariç) Az Tehlikeli
85.3 Ortaöğretim
85.31 Genel ortaöğretim
85.31.12 Kamu kurumları tarafındanverilen genel ortaöğretim (lise)faaliyeti (engellilere yönelikverilen eğitim hariç) Az Tehlikeli
85.31.13 Kamu kurumları tarafındanverilen fiziksel veya zihinselengellilere yönelik genelortaöğretim (lise) faaliyeti Az Tehlikeli
85.31.14 Özel öğretim kurumlarıtarafından verilen genelortaöğretim (lise) faaliyeti(engellilere yönelik verilen eğitimhariç) Az Tehlikeli
85.31.16 Özel öğretim kurumlarıtarafından verilen fiziksel veyazihinsel engellilere yönelik genelortaöğretim (lise) faaliyeti Az Tehlikeli
85.32 Teknik ve mesleki ortaöğretim
85.32.10 Kamu kurumları tarafındanverilen fiziksel veya zihinselengellilere yönelik teknik vemesleki ortaöğretim (lise)faaliyeti Az Tehlikeli
85.32.11 Kamu kurumları tarafındanverilen teknik ve meslekiortaöğretim (lise) faaliyeti(engellilere yönelik verilen eğitimhariç) Tehlikeli
85.32.12 Özel öğretim kurumlarıtarafından verilen fiziksel veyazihinsel engellilere yönelik teknikve mesleki ortaöğretim (lise)faaliyeti Az Tehlikeli
85.32.13 Özel öğretim kurumlarıtarafından verilen teknik vemesleki ortaöğretim (lise)faaliyeti (engellilere yönelikverilen eğitim hariç) Tehlikeli
85.32.14 Çıraklık eğitimi Tehlikeli
85.32.15 Ticari sertifika verenhavacılık, yelkencilik, gemicilik,vb. kursların faaliyetleri Tehlikeli
85.32.16 Ticari taşıt kullanma belgesiveren sürücü kurslarınınfaaliyetleri Az Tehlikeli
85.32.90 Mesleki amaçlı eğitim verendiğer kursların faaliyetleri Az Tehlikeli
85.4 Ortaöğretim sonrasıyükseköğretim derecesinde olmayaneğitim ve yükseköğretim
85.41 Ortaöğretim sonrasıyükseköğretim derecesinde olmayaneğitim
85.41.01 Ortaöğretim sonrasıyükseköğretim derecesinde olmayaneğitim faaliyeti Az Tehlikeli
85.42 Yükseköğretim
85.42.01 Kamu kurumları tarafındanverilen yükseköğretim faaliyeti(yükseköğretim düzeyinde eğitimsağlayan konservatuarlardahil) Az Tehlikeli
85.42.03 Özel öğretim kurumlarıtarafından verilen yükseköğretimfaaliyeti (yükseköğretim düzeyindeeğitim sağlayan konservatuarlardahil) Az Tehlikeli
85.5 Diğer eğitim
85.51 Spor ve eğlence eğitimi
85.51.03 Spor ve eğlence eğitim kursları(futbol, dövüş sanatları,jimnastik, binicilik, yüzme,dalgıçlık, paraşüt, briç, yoga, vb.eğitimi ile profesyonel sporeğitimcilerinin faaliyetleri dahil,temel, orta ve yükseköğretimdüzeyinde verilen eğitimhariç) Az Tehlikeli
85.52 Kültürel eğitim
85.52.05 Kültürel eğitim veren kurslarınfaaliyeti (bale, dans, müzik,fotoğraf, halk oyunu, resim, drama,vb. eğitimi dahil, temel, orta veyükseköğretim düzeyinde verileneğitim hariç) Az Tehlikeli
85.53 Sürücü kursu faaliyetleri
85.53.01 Sürücü kursu faaliyetleri(ticari sertifika veren sürücülük,havacılık, yelkencilik, gemicilikeğitimi hariç) Az Tehlikeli
85.59 Başka yerde sınıflandırılmamışdiğer eğitim
85.59.01 Halk eğitim merkezlerininfaaliyetleri Az Tehlikeli
85.59.03 Bilgisayar, yazılım,veritabanı, vb. eğitimi verenkursların faaliyetleri (temel, ortave yükseköğretim düzeyinde verileneğitim hariç) Az Tehlikeli
85.59.05 Orta öğretime, yüksek öğretime,kamu personeli, vb. sınavlarayönelik yardımcı dersler verendershanelerin faaliyetleri Az Tehlikeli
85.59.06 Biçki, dikiş, nakış, halıcılık,güzellik, berberlik, kuaförlükkurslarının faaliyetleri Az Tehlikeli
85.59.08 Kuran kursları ve diğer dinieğitim veren yerlerin faaliyetleri(temel, orta ve yükseköğretimdüzeyinde verilen eğitimhariç) Az Tehlikeli
85.59.09 Dil ve konuşma becerilerieğitimi veren kurslarınfaaliyetleri (temel, orta veyükseköğretim düzeyinde verileneğitim hariç) Az Tehlikeli
85.59.10 Mankenlik, modelistlik,stilistlik kurslarınınfaaliyetleri Az Tehlikeli
85.59.12 Muhasebe eğitimi kurslarınınfaaliyeti Az Tehlikeli
85.59.15 Akademik özel ders vermefaaliyeti (temel, orta veyükseköğretim düzeyinde bire bireğitim) Az Tehlikeli
85.59.90 Başka yerde sınıflandırılmamışdiğer eğitim kursu faaliyetleri(cankurtaranlık, hayatta kalma,topluluğa konuşma, hızlı okuma, vb.eğitimi dahil, yetişkin okuma yazmaprogramları ile temel, orta veyükseköğretim düzeyinde verileneğitim hariç) Az Tehlikeli
85.6 Eğitimi destekleyicifaaliyetler
85.60 Eğitimi destekleyicifaaliyetler
85.60.02 Eğitimi destekleyicifaaliyetler (eğitim rehberlik,danışmanlık, test değerlendirme,öğrenci değişim programlarınınorganizasyonu, yaprak test ve sorubankası hazırlama gibi eğitimidestekleyen öğrenim dışıfaaliyetler) Az Tehlikeli
Q İNSAN SAĞLIĞI VE SOSYAL HİZMETFAALİYETLERİ
86 İnsan sağlığı hizmetleri
86.1 Hastane hizmetleri
86.10 Hastane hizmetleri
86.10.04 Kamu kurumları tarafındanverilen insan sağlığına yöneliközel ihtisas gerektiren yataklıhastane hizmetleri (kadın doğum,onkoloji, kemik, ruh ve sinirhastalıkları hastaneleri, vb.) Çok Tehlikeli
86.10.05 Kamu kurumları tarafındanverilen insan sağlığına yönelikyataklı hastane hizmetleri (devletüniversite hastaneleri dahil, özelihtisas hastaneleri ile dişçilik,ambulansla taşıma, tıbbilaboratuvar test faaliyetlerihariç) Çok Tehlikeli
86.10.12 Özel sağlık kurumlarıtarafından verilen insan sağlığınayönelik özel ihtisas gerektirenyataklı hastane hizmetleri (kadındoğum, onkoloji, kemik, ruh vesinir hastalıkları hastaneleri,vb.) Çok Tehlikeli
86.10.13 Özel sağlık kurumlarıtarafından verilen insan sağlığınayönelik yataklı hastane hizmetleri(özel veya vakıf üniversitehastaneleri dahil, dişçilik,ambulansla taşıma, tıbbilaboratuvar testleri faaliyetlerihariç) Çok Tehlikeli
86.2 Tıp ve dişçilik ile ilgiliuygulama faaliyetleri
86.21 Genel hekimlik uygulamafaaliyetleri
86.21.02 Aile ve toplum sağlığımerkezleri tarafından sağlananyatılı olmayan genel hekimlikuygulama faaliyetleri (yatılıhastane faaliyetleri ile ebeler,hemşireler ve fizyoterapistlercegerçekleştirilen paramedikalfaaliyetler hariç) Tehlikeli
86.21.03 Özel sağlık kurumlarıtarafından polikliniklerde sağlananyatılı olmayan genel hekimlikuygulama faaliyetleri (özel muayeneve yatılı hastane faaliyetleri ileebe, hemşire ve fizyoterapistlerinparamedikal faaliyetlerihariç) Tehlikeli
86.21.04 Özel muayenehanelerde sağlananyatılı olmayan genel hekimlikuygulama faaliyetleri (hastane vepoliklinik faaliyetleri ile ebe,hemşire ve fizyoterapistlerinparamedikal faaliyetlerihariç) Tehlikeli
86.21.90 Diğer yatılı olmayan genelhekimlik uygulama faaliyetleri (ev,iş yeri, okul vb. yerlerdesağlananlar dahil, ebe, hemşire vefizyoterapistlerin paramedikalfaaliyetleri hariç) Tehlikeli
86.22 Uzman hekimlik ile ilgiliuygulama faaliyetleri
86.22.02 Özel muayenehanelerde sağlananuzman hekimlik ile ilgili yatılıolmayan uygulama faaliyetleri(hastane ve poliklinik faaliyetleriile ebe, hemşire vefizyoterapistlerin paramedikalfaaliyetleri hariç) Tehlikeli
86.22.05 Özel sağlık kurumlarıtarafından poliklinik ve yatılıolmayan tıp merkezlerinde sağlananuzman hekimlik ile ilgili uygulamafaaliyetleri (yatılı hastanefaaliyetleri ile ebe, hemşire vefizyoterapistlerin paramedikalfaaliyetleri hariç) Tehlikeli
86.22.06 Aile ve toplum sağlığımerkezleri tarafından sağlananyatılı olmayan uzman hekimlikuygulama faaliyetleri (yatılıhastane faaliyetleri ile ebe,hemşire ve fizyoterapistlerinparamedikal faaliyetlerihariç) Tehlikeli
86.22.07 Diyaliz merkezleri (hastanedışı) Tehlikeli
86.22.90 Diğer yatılı olmayan uzmanhekimlik uygulama faaliyetleri (ev,iş yeri, okul vb. yerlerdesağlananlar dahil, ebe, hemşire vefizyoterapistlerin paramedikalfaaliyetleri hariç) Tehlikeli
86.23 Dişçilik ile ilgili uygulamafaaliyetleri
86.23.01 Özel sağlık kurumlarıtarafından sağlanan diş hekimliğiuygulama faaliyetleri (yatılıhastane faaliyetleri ile dişhijyenistleri gibi paramedikal dişsağlığı personelinin faaliyetlerihariç) Tehlikeli
86.23.03 Özel muayenehanelerde sağlanandiş hekimliği uygulama faaliyetleri(yatılı hastane faaliyetleri ilediş hijyenistleri gibi paramedikaldiş sağlığı personelininfaaliyetleri hariç) Tehlikeli
86.23.05 Kamu kurumları tarafındansağlanan diş hekimliği uygulamafaaliyetleri (yatılı hastanefaaliyetleri ile diş hijyenistlerigibi paramedikal diş sağlığıpersonelinin faaliyetlerihariç) Tehlikeli
86.9 İnsan sağlığı ile ilgili diğerhizmetler
86.90 İnsan sağlığı ile ilgili diğerhizmetler
86.90.01 Hemşirelik hizmetleri (evdekihastalar için bakım, koruma, annebakımı, çocuk sağlığı ve hemşirelikbakımı alanındaki benzeri hizmetlerdahil, hemşireli yatılı bakımtesislerinin faaliyetleri ile tıpdoktorlarının hizmetleri hariç)(hastane dışı) Tehlikeli
86.90.03 Tıp doktorları dışında yetkilikişilerce sağlanan akupunkturlatedavi faaliyeti (hastanedışı) Tehlikeli
86.90.04 Ambulansla hasta taşımafaaliyeti (hastane dışı) Tehlikeli
86.90.05 Ebe, sağlık memuru, sünnetçi,iğneci, pansumancı vb.leritarafından verilen hizmetler (tıpdoktorları dışında yetkilikişilerce sağlanan gebeliksüresince ve doğum sonrası izlemeve tıbbi işlemleri kapsayan aileplanlaması hizmetleri dahil)(hastane dışı) Tehlikeli
86.90.06 Fizyoterapi hizmetleri (tıpdoktorları dışında yetkilikişilerce sağlanan fizyoterapi,ergoterapi vb. alanlardakihizmetler) (hastane dışı) Tehlikeli
86.90.07 Analiz veya raporlamaolmaksızın teşhis amaçlıgörüntüleme hizmetleri (tıpdoktorları dışında yetkilikişilerce sağlanan röntgen,ultrason, manyetik rezonans (MR)vb. görüntüleme hizmetleri)(hastane dışı) Çok Tehlikeli
86.90.09 Kan, sperm ve organbankalarının faaliyetleri (hastanedışı) Çok Tehlikeli
86.90.10 Tıbbi laboratuvarlarınhizmetleri (adli tıp ve dişlaboratuvarlarının faaliyetlerihariç) (hastane dışı) Çok Tehlikeli
86.90.14 Tıp doktorları dışında yetkilikişilerce sağlanan akıl sağlığıhizmetleri (psikoanalistler,psikologlar ve psikoterapistlertarafından sağlanan hizmetler)(hastane dışı) Az Tehlikeli
86.90.16 Adli tıp laboratuvarlarınınfaaliyetleri Çok Tehlikeli
86.90.90 Bys. diğer paramedikal insansağlığı hizmetleri (tıp doktorlarıdışında yetkili kişilerce sağlananmesleki terapi, aroma terapi,konuşma terapisi, homeopati, besintedavisi, ayak bakımı, diş hijyenivb. hizmetler) (hastane dışı) Az Tehlikeli
87 Yatılı bakım faaliyetleri
87.1 Hemşireli yatılı bakımfaaliyetleri
87.10 Hemşireli yatılı bakımfaaliyetleri
87.10.01 Hemşireli yatılı bakımfaaliyetleri (hemşireli bakımevlerinin, hemşireli huzurevlerinin faaliyetleri dahil,sadece asgari düzeyde hemşirebakımı sağlanan yaşlı evlerinin,yetimhanelerin, yurtlarınfaaliyetleri ile evlerde sağlananhizmetler hariç) Tehlikeli
87.2 Zihinsel engellilik, ruhsağlığı ve madde bağımlılığınayönelik yatılı bakımfaaliyetleri
87.20 Zihinsel engellilik, ruhsağlığı ve madde bağımlılığınayönelik yatılı bakımfaaliyetleri
87.20.02 Zihinsel engellilik, ruhsağlığı ve madde bağımlılığınayönelik yatılı bakım faaliyetleri(hastanelerin faaliyetleri ileyatılı sosyal hizmet faaliyetlerihariç) Tehlikeli
87.3 Yaşlılara ve bedenselengellilere yönelik yatılı bakımfaaliyetleri
87.30 Yaşlılara ve bedenselengellilere yönelik yatılı bakımfaaliyetleri
87.30.02 Yaşlılara ve bedenselengellilere yönelik yatılı bakımfaaliyetleri (destekli yaşamtesisleri, hemşire bakımı olmayanhuzurevleri ve asgari düzeydehemşire bakımı olan evlerinfaaliyetleri dahil, yaşlılar içinhemşire bakımlı evlerinfaaliyetleri hariç) Tehlikeli
87.9 Diğer yatılı bakımfaaliyetleri
87.90 Diğer yatılı bakımfaaliyetleri
87.90.03 Çocuklara ve gençlere yönelikdiğer yatılı bakım faaliyetleri(kimsesiz çocuklar için sosyalhizmetler, çocuk bakım evleridahil, çocuk ıslah evlerinin vehemşireli bakım tesislerininfaaliyetleri ile bedenselengelliler için olanlar hariç) Az Tehlikeli
87.90.04 Çocuklara ve gençlere yönelikıslah evleri ile çocuk suçlu vesabıkalılar için bakım evlerincesağlanan diğer yatılı bakımfaaliyetleri Az Tehlikeli
87.90.90 Yetişkinlere yönelik bys diğeryatılı bakım faaliyetleri (sığınmaevleri, geçici evsiz barınakları,suçlu ve sabıkalılar için bakımevleri dahil, hemşireli bakımtesislerinin faaliyetleri ileyaşlılar ve bedensel engellileriçin olanlar hariç) Az Tehlikeli
88 Barınacak yer sağlanmaksızınverilen sosyal hizmetler
88.1 Yaşlılar ve bedensel engellileriçin barınacak yer sağlanmaksızınverilen sosyal hizmetler
88.10 Yaşlılar ve bedensel engellileriçin barınacak yer sağlanmaksızınverilen sosyal hizmetler
88.10.02 Yaşlılar ve bedensel engellileriçin barınacak yer sağlanmaksızınverilen sosyal hizmetler (yatılıbakım faaliyetleri ile engelliçocuklara yönelik gündüz bakım(kreş) faaliyetleri hariç) Az Tehlikeli
88.9 Barınacak yer sağlanmaksızınverilen diğer sosyal hizmetler
88.91 Çocuk gündüz bakım (kreş)faaliyetleri
88.91.01 Çocuk gündüz bakım (kreş)faaliyetleri (engelli çocuklar içinolanlar ile bebek bakıcılığı dahil,okul öncesi eğitim faaliyetlerihariç) Az Tehlikeli
88.99 Başka yerde sınıflandırılmamışbarınacak yer sağlanmaksızınverilen diğer sosyal yardımhizmetleri
88.99.07 Barınacak yer sağlanmaksızınmesleki rehabilitasyon hizmetleri(bedensel engelliler içinrehabilitasyon hizmetlerihariç) Az Tehlikeli
88.99.08 Bys. barınacak yersağlanmaksızın verilen diğer sosyalyardım hizmetleri (aile rehberliği,borç danışmanlığı, sosyal hizmetiçin para toplama, evlat edindirme,evsiz, afetzede ve mültecileregeçici barınak sağlama, yardım içinuygun kişi belirleme, vb.) Az Tehlikeli
88.99.09 Barınacak yer sağlanmaksızınçocuk ve gençlere yönelikrehabilitasyon hizmetleri (zihinselengelliler için olanlar dahil,bedensel engellilere yönelikolanlar hariç) Az Tehlikeli
R KÜLTÜR, SANAT, EĞLENCE,DİNLENCE VE SPOR
90 Yaratıcı sanatlar, gösterisanatları ve eğlencefaaliyetleri
90.0 Yaratıcı sanatlar, gösterisanatları ve eğlencefaaliyetleri
90.01 Gösteri sanatları
90.01.14 Canlı tiyatro, opera, bale,müzikal, konser vb. yapımlarınsahneye konulması faaliyetleri(illüzyon gösterileri, kuklagösterileri ve kumpanyalardahil) Az Tehlikeli
90.01.15 Orkestra ve bandolarınfaaliyetleri Az Tehlikeli
90.01.16 Bağımsız müzisyen, sessanatçısı, konuşmacı, sunucuvb.lerin faaliyetleri (müzikgrupları dahil) Az Tehlikeli
90.01.17 Bağımsız manken ve modellerinfaaliyetleri Az Tehlikeli
90.01.18 Bağımsız aktör, aktrist vedublörlerin faaliyetleri Az Tehlikeli
90.01.20 Sirklerin faaliyetleri Tehlikeli
90.01.90 Bys. diğer gösterisanatları Az Tehlikeli
90.02 Gösteri sanatlarınıdestekleyici faaliyetler
90.02.11 Gösteri sanatlarına yönelikyönetmenlerin ve yapımcılarınfaaliyetleri Az Tehlikeli
90.02.12 Gösteri sanatlarına yönelikdiğer destekleyici faaliyetler(sahne tasarımcıları, dekoratörlerive kostüm tasarımcılarınınfaaliyetleri ile gösteri için dekorve arka perdenin, ışıklandırma veses ekipmanlarınınişletilmesi) Tehlikeli
90.03 Sanatsal yaratıcılıkfaaliyetleri
90.03.09 Yazar, bestekar, heykeltıraş,ressam, karikatürcü, gravürcü, ebrusanatçısı, vb. bireyselsanatçıların faaliyetleri(hakkakçılık, hattatçılık, eşya vemotif süslemeciliği (tezyinatçılık)dahil) Az Tehlikeli
90.03.11 Bağımsız gazetecilerinfaaliyetleri Az Tehlikeli
90.03.12 Tablo, gravür vb. sanateserlerinin restorasyonu (müzelerdeve özel koleksiyonlarda yer alaneserlerin restorasyonu dahil) Az Tehlikeli
90.04 Sanat tesislerininişletilmesi
90.04.01 Sanat tesislerinin işletilmesi(sanat galerileri, konser vetiyatro salonları ve diğer sanattesisleri) Az Tehlikeli
91 Kütüphaneler, arşivler, müzelerve diğer kültürel faaliyetler
91.0 Kütüphaneler, arşivler, müzelerve diğer kültürel faaliyetler
91.01 Kütüphane ve arşivlerinfaaliyetleri
91.01.02 Kütüphane ve arşivlerinfaaliyetleri (devlet arşivleridahil) Az Tehlikeli
91.02 Müzelerin faaliyetleri
91.02.01 Müzelerin faaliyetleri Az Tehlikeli
91.03 Tarihi alanlar ve yapılar ilebenzeri turistik yerlerinişletilmesi
91.03.02 Tarihi alanlar ve yapılar ilebenzeri turistik yerlerinişletilmesi (tarihi alanların veyapıların korunması dahil) Az Tehlikeli
91.04 Botanik bahçeleri, hayvanatbahçeleri ve tabiatı korumaalanlarıyla ilgili faaliyetler
91.04.02 Botanik bahçeleri, hayvanatbahçeleri ve tabiatı korumaalanlarıyla ilgili faaliyetler(milli parklar dahil) Tehlikeli
92 Kumar ve müşterek bahisfaaliyetleri
92.0 Kumar ve müşterek bahisfaaliyetleri
92.00 Kumar ve müşterek bahisfaaliyetleri
92.00.01 Müşterek bahis faaliyetleri (atyarışı, köpek yarışı, futbol vediğer spor yarışmaları konusundabahis hizmetleri) Az Tehlikeli
92.00.02 Loto, vb. sayısal şansoyunlarına ilişkin faaliyetler(piyango biletlerinin satışıdahil) Az Tehlikeli
92.00.03 Kumarhanelerin faaliyetleri(çevrim içi olanlar dahil) Az Tehlikeli
93 Spor faaliyetleri, eğlence vedinlence faaliyetleri
93.1 Spor faaliyetleri
93.11 Spor tesislerininişletilmesi
93.11.01 Spor tesislerinin işletilmesi(futbol, hokey, paten, golf, vb.sahaları, yarış pistleri,stadyumlar, yüzme havuzları, teniskortları, bovling alanları, boksarenaları, vb. tesisler) Az Tehlikeli
93.11.02 Hipodromların işletilmesi Az Tehlikeli
93.12 Spor kulüplerininfaaliyetleri
93.12.01 Atıcılık ve okçulukkulüplerinin faaliyetleri Tehlikeli
93.12.03 Futbol, voleybol, basketbol vb.kulüplerinin faaliyetleri Az Tehlikeli
93.12.04 Güreş kulüplerininfaaliyetleri Az Tehlikeli
93.12.05 Jokey kulüplerininfaaliyetleri Az Tehlikeli
93.12.06 Tenis kulüplerininfaaliyetleri Az Tehlikeli
93.12.07 Yüzme kulüplerininfaaliyetleri Az Tehlikeli
93.12.09 Atletizm kulüplerininfaaliyetleri Az Tehlikeli
93.12.90 Diğer spor kulüplerininfaaliyetleri (golf, bovling,satranç, kayak, buz pateni, vb.kulüpleri) Az Tehlikeli
93.13 Form tutma salonları ile vücutgeliştirme salonları
93.13.01 Form tutma ve vücut geliştirmesalonlarının faaliyetleri Az Tehlikeli
93.19 Diğer spor faaliyetleri
93.19.01 Kendi hesabına bireysel çalışanatlet, hakem, zaman tutucu,antrenör, spor eğitmeni vb.sporcuların faaliyetleri Az Tehlikeli
93.19.02 Spor ve eğlence amaçlı sporetkinliği ve karşılaşmasıdüzenleyicilerinin veorganizatörlerin faaliyetleri Az Tehlikeli
93.19.03 Spor ve eğlence amaçlı sporlarailişkin destek hizmetler(balıkçılık ve avcılık sporalanlarının işletilmesi, avcılık,balıkçılık ve dağcılık rehberliği,yarış atı ahırı ve yarış aracıgarajlarının hizmetleri, spor veeğlence hayvanlarının eğitimi,vb.) Tehlikeli
93.19.04 Spor ligleri ve düzenleyicibirimlerin faaliyetleri Az Tehlikeli
93.19.05 Bilardo salonlarınınfaaliyetleri Az Tehlikeli
93.19.06 Atış poligonlarınınfaaliyetleri Tehlikeli
93.19.90 Diğer spor ve eğlence amaçlıspor hizmetleri (paraşüthizmetleri, delta-kanat hizmetleri,dalgıçlık hizmetleri ve bys. Diğerspor ve eğlence hizmetleri) Tehlikeli
93.2 Eğlence ve dinlencefaaliyetleri
93.21 Eğlence parkları velunaparkların faaliyetleri
93.21.01 Eğlence parkları velunaparkların faaliyetleri Tehlikeli
93.29 Diğer eğlence ve dinlencefaaliyetleri
93.29.01 Plaj alanlarının işletilmesi(bu tesislerin bütünleyici birparçası olan soyunma odası, dolap,sandalye, kano, deniz motosikletivb. kiralanması dahil) Az Tehlikeli
93.29.02 Düğün, balo ve kokteylsalonlarının işletilmesi (yiyecekve içecek sunum hizmetlerihariç) Az Tehlikeli
93.29.03 Bozuk para veya jetonla çalışanoyun makinelerinin işletilmesi(langırt, tilt, atari salonları,vb.) Az Tehlikeli
93.29.05 Dans pistlerinin, diskoteklerinişletilmesi (içecek sunumhizmetleri hariç) Az Tehlikeli
93.29.07 Marina, vb. dinlence amaçlıulaştırma tesislerininişletilmesi Az Tehlikeli
93.29.08 Havai fişek ile “ses ve ışık”gösterisi faaliyetleri Tehlikeli
93.29.09 Kayak pistlerininişletilmesi Az Tehlikeli
93.29.10 Dinlence (rekreasyon)parklarının faaliyetleri(konaklamalı olanlar ile eğlenceparkları ve lunaparklarınişletilmesi hariç) Az Tehlikeli
93.29.90 Başka yerde sınıflandırılmamışçeşitli eğlence hizmetleri (boğagüreşi, rodeo vb.) Tehlikeli
S DİĞER HİZMET FAALİYETLERİ
94 Üye olunan kuruluşlarınfaaliyetleri
94.1 İş, işveren ve meslekkuruluşlarının faaliyetleri
94.11 İş ve işveren kuruluşlarınınfaaliyetleri
94.11.03 Esnaf ve sanatkar odaları,birlikleri ve üst kuruluşlarınınfaaliyetleri Az Tehlikeli
94.11.04 Çiftçi ve ziraat odaları,birlikleri ve üst kuruluşlarınınfaaliyetleri Az Tehlikeli
94.11.05 Ticaret ve sanayi odaları veüst kuruluşlarınınfaaliyetleri Az Tehlikeli
94.11.06 İşveren sendikalarınınfaaliyetleri Az Tehlikeli
94.11.90 Diğer iş ve işveren odaları,birlikleri ve üst kuruluşlarınınfaaliyetleri (işçi, işveren vememur sendikaları hariç) Az Tehlikeli
94.12 Profesyonel meslekkuruluşlarının faaliyetleri
94.12.01 Baroların faaliyetleri Az Tehlikeli
94.12.05 Mesleki birlikler, dernekler veodaların faaliyetleri (mimar,mühendis, tabip, muhasebeci, yazarvb. dernek ve odaları) (barolarhariç) Az Tehlikeli
94.12.90 Diğer profesyonel meslekkuruluşlarının faaliyetleri Az Tehlikeli
94.2 Sendika faaliyetleri
94.20 Sendika faaliyetleri
94.20.01 İşçi ve memur sendikalarınınfaaliyetleri (üst kuruluşlarıdahil) Az Tehlikeli
94.9 Diğer üyelikorganizasyonlarınınfaaliyetleri
94.91 Dini kuruluşlarınfaaliyetleri
94.91.02 Üyelik gerektiren dinikuruluşların faaliyetleri (cami,kilise, sinagog vb. yerlerde ibadetedenlere doğrudan hizmet sağlayandini organizasyonların veyakişilerin faaliyetleri vb.) Az Tehlikeli
94.92 Siyasi kuruluşlarınfaaliyetleri
94.92.02 Siyasi kuruluşlarınfaaliyetleri (siyasi partiler,vb.) Az Tehlikeli
94.99 Başka yerde sınıflandırılmamışdiğer üye olunan kuruluşlarınfaaliyetleri
94.99.01 Üyelik gerektiren çevre vedoğal hayatın korunmasına yönelikdernek ve birliklerin faaliyetleri(vahşi yaşamı koruma kuruluşlarıdahil) Az Tehlikeli
94.99.02/td> Üyelik gerektiren gençlikdernek ve birliklerininfaaliyetleri (öğrenci birlikleriile izci birlik ve kulüpleridahil) Az Tehlikeli
94.99.03 Üyelik gerektiren yurtseverdernek ve birliklerininfaaliyetleri (savaş gazisibirlikleri vb.) Az Tehlikeli
94.99.04 Üyelik gerektiren hayvanlarıkoruma dernek ve birliklerininfaaliyetleri (hayvanları korumaderneği, vb.) Az Tehlikeli
94.99.05 Üyelik gerektiren kadın haklarıkoruma dernek ve birliklerininfaaliyetleri Az Tehlikeli
94.99.08 Okul aile birlikleri Az Tehlikeli
94.99.09 Üyelik gerektiren kültür,dayanışma ve eğlence dernek vebirliklerinin faaliyetleri Az Tehlikeli
94.99.12 Üyelik gerektiren ideoloji vedüşünce kuruluşlarının vederneklerinin faaliyetleri Az Tehlikeli
94.99.13 Üyelik gerektiren sivil aramave kurtarma dernek ve birliklerininfaaliyetleri (sivil savunmafaaliyetleri hariç) Tehlikeli
94.99.14 Üyelik gerektiren bireyselözgürlük ve insan hakları dernek vebirliklerinin faaliyetleri Az Tehlikeli
94.99.15 Üyelik gerektiren gönüllüsağlık dernek ve birliklerininfaaliyetleri Az Tehlikeli
94.99.16 Engellilere, etnik gruplara veazınlıklara yönelik üyelikgerektiren birlik ve kuruluşlarınfaaliyetleri Az Tehlikeli
94.99.17 Üyelik gerektiren toplumsalhayatı geliştirme ve iyileştirmeyeyönelik oluşturulan birlik vekuruluşların faaliyetleri Az Tehlikeli
94.99.18 Üyelik gerektiren tüketicihaklarını savunan birlikler vekuruluşların faaliyetleri Az Tehlikeli
94.99.19 Havacılığın geliştirilmesineyönelik üyelik gerektiren kuruluşve derneklerin faaliyetleri Az Tehlikeli
94.99.20 Üye olunan derneklerin üstkuruluşları ve üst birlikleri (iş,işveren ve mesleki birlik vederneklerin üst kuruluşlarıhariç) Az Tehlikeli
94.99.21 Üyelik gerektiren yardımkuruluşlarının ve derneklerininfaaliyetleri (doğal afetlerde zarargörenler, evsizler, fakirler içinorganizasyonlar, vb.) (arama vekurtarma hariç) Az Tehlikeli
94.99.22 Üyelik gerektiren eğitim vearaştırma birlik ve derneklerininfaaliyetleri Az Tehlikeli
94.99.23 Üyelik gerektiren konut vekalkınma birlik ve derneklerininfaaliyetleri Az Tehlikeli
94.99.24 Üyelik gerektiren mezun dernekve birliklerinin faaliyetleri(profesyonel meslek kuruluşlarıhariç) Az Tehlikeli
94.99.90 Üyelik gerektiren başka yerdesınıflandırılmamış diğer üye olunankuruluşların faaliyetleri (klasikaraba birlikleri, kiracıbirlikleri, vb. dahil) Az Tehlikeli
95 Bilgisayarların, kişiseleşyaların ve ev eşyalarınınonarımı
95.1 Bilgisayarların ve iletişimaraç ve gereçlerinin onarımı
95.11 Bilgisayarların ve bilgisayarçevre birimlerinin onarımı
95.11.01 Bilgisayarların ve bilgisayarçevre birimlerinin onarımı (ATM’lerve pos cihazları dahil) Az Tehlikeli
95.12 İletişim araç ve gereçlerininonarımı
95.12.01 İletişim araç ve gereçlerininonarımı (kablosuz telefonlar,telsizler, cep telefonları, çağrıcihazları, ticari kameralarvb.) Az Tehlikeli
95.2 Kişisel eşyalar ile eveşyalarının onarımı
95.21 Tüketici elektroniğiürünlerinin onarımı
95.21.01 Tüketici elektroniğiürünlerinin bakım ve onarımı(televizyon, radyo, CD/DVDoynatıcıları, ev tipi videokameraları vb.) Az Tehlikeli
95.22 Evde kullanılan cihazlar ile evve bahçe gereçlerinin onarımı
95.22.01 Evde kullanılan elektriklicihazların onarımı (buzdolabı,fırın, çamaşır makinesi, bulaşıkmakinesi, oda kliması, elektrikliküçük ev aletleri, vb.) Tehlikeli
95.22.02 Ev ve bahçe gereçlerininonarımı (mutfak eşyası, makas, çimbiçme makinesi, budama makasları,vb.) Az Tehlikeli
95.22.03 Termosifon, şofben, banyokazanı vb. bakım ve onarımı(merkezi ısıtma kazanlarının(boylerler) onarımı hariç) Tehlikeli
95.23 Ayakkabı ve deri eşyalarınonarımı
95.23.01 Ayakkabı ve deri eşyalarınonarımı (ayakkabı, valiz, elçantası, vb.) (deri giyim eşyasıhariç) Tehlikeli
95.24 Mobilyaların ve evdöşemelerinin onarımı
95.24.01 Mobilyaların ve evdöşemelerinin onarımı (büro ve evmobilyalarının yeniden döşenmesi,kaplanması, onarımı ve yenilenmesidahil, halı ve kilim onarımıhariç) Tehlikeli
95.25 Saatlerin ve mücevherlerinonarımı
95.25.01 Saatlerin onarımı(kronometreler dahil, devam kayıtcihazları hariç) Az Tehlikeli
95.25.02 Mücevherlerin onarımı Tehlikeli
95.29 Başka yerde sınıflandırılmamışdiğer kişisel eşyaların ve eveşyalarının onarımı
95.29.02 Giyim eşyası ve ev tekstilürünlerinin onarımı ve tadilatı(deri giyim eşyaları hariç) Az Tehlikeli
95.29.03 Spor araç ve gereçleri ile kampmalzemelerinin bakımı ve onarımı(kayak, sörf tahtası, paten, raket,diğer spor ve açık hava oyunlarınaait eşya ve ekipmanlar) (spor veeğlence amaçlı silahların onarımıhariç) Az Tehlikeli
95.29.04 Çilingirlik ve anahtar çoğaltmahizmetleri Az Tehlikeli
95.29.05 Bisiklet onarımı Az Tehlikeli
95.29.06 Müzik aletlerinin bakım veonarımı (piyano akordu dahil) Az Tehlikeli
95.29.07 Deri ve deri bileşimli giyimeşyaları ile kürk giyim eşyalarınınonarımı Az Tehlikeli
95.29.90 Başka yerde sınıflandırılmamışdiğer kişisel ve ev eşyalarınınbakım ve onarımı (kitap, aydınlatmaeşyaları, oyuncak, vb. onarımı ilekimlik kartlarının plastiklekaplanması dahil) Az Tehlikeli
96 Diğer hizmet faaliyetleri
96.0 Diğer hizmet faaliyetleri
96.01 Tekstil ve kürk ürünlerininyıkanması ve (kuru)temizlenmesi
96.01.01 Çamaşırhane hizmetleri (paraveya jetonla çalışan makinelerleyapılanlar dahil) Az Tehlikeli
96.01.02 Halı ve kilim yıkamahizmetleri Az Tehlikeli
96.01.03 Giyim eşyası ve diğer tekstilürünlerini boyama ve renklendirmehizmetleri (imalat aşamasındayapılanlar hariç) Tehlikeli
96.01.04 Kuru temizleme hizmetleri(giysi ve diğer tekstilürünlerinin, kürk ve deriürünlerinin kuru temizlenmesi) Çok Tehlikeli
96.01.05 Giyim eşyası ve diğer tekstilürünlerini ütüleme hizmetleri (presve silindir ütüleme hizmetleridahil) Tehlikeli
96.02 Kuaförlük ve diğer güzelliksalonlarının faaliyetleri
96.02.01 Güzellik salonlarınınfaaliyetleri (cilt bakımı, kaşalma, ağda, manikür, pedikür vb.ninbir arada sunulduğu salonlar)(sağlık bakım hizmetlerihariç) Tehlikeli
96.02.02 Erkekler için kuaför ve berberişletmelerinin faaliyetleri Tehlikeli
96.02.03 Kadınlar için kuaförişletmelerinin faaliyetleri Tehlikeli
96.02.04 Sadece manikür ve pedikürhizmeti sunan salonlarınfaaliyetleri Tehlikeli
96.02.05 Sadece ağdacılık hizmeti sunansalonların faaliyetleri Tehlikeli
96.03 Cenaze işleri ile ilgilifaaliyetler
96.03.01 Cenaze işleri ile ilgilifaaliyetler (cenaze yıkamayerlerinin işletilmesi, cenazeninnakli, yıkama hizmetleri, mezaryeri satışı, defin hizmetleri,cenaze levazımatçılığı vb.) Az Tehlikeli
96.04 Hamam, sauna, solaryum salonu,masaj salonu ve benzeri yerlerinfaaliyetleri
96.04.01 Hamam, sauna, vb. yerlerinfaaliyetleri Tehlikeli
96.04.02 Kaplıca, ılıca, içmeler, spamerkezleri, vb. yerlerinfaaliyetleri (konaklama hizmetlerihariç) Tehlikeli
96.04.03 Zayıflama salonu, masaj salonu,solaryum, vb. yerlerin işletilmesifaaliyetleri (form tutmasalonlarının ve diyetisyenlerinfaaliyetleri hariç) Tehlikeli
96.09 Başka yerde sınıflandırılmamışdiğer hizmet faaliyetleri
96.09.01 Ayakkabı boyama hizmetleri Az Tehlikeli
96.09.02 Nikah salonlarınınhizmetleri Az Tehlikeli
96.09.03 Fal , astroloji ve spiritualisthizmetleri Az Tehlikeli
96.09.04 Genel tuvaletlerin işletilmesifaaliyeti Az Tehlikeli
96.09.05 Hamallık hizmetleri Tehlikeli
96.09.07 Kendi hesabına çalışanvalelerin hizmetleri Az Tehlikeli
96.09.08 Eskort ve refakat hizmetleri(güvenlik hizmetleri hariç) Az Tehlikeli
96.09.09 Tanıştırma bürolarının veevlendirme ajanslarınınhizmetleri Az Tehlikeli
96.09.10 Kendi hesabına çalışan yamak,garson, vb. hizmet sunanlarınfaaliyetleri Az Tehlikeli
96.09.12 Genelev hizmetleri Tehlikeli
96.09.14 Ev hayvanları bakım hizmetleri(ev hayvanlarına verilen besleme,bakım, barındırma, kuaförlük,eğitim, vb. hizmetler) Tehlikeli
96.09.15 Şecere bulma faaliyetleri Az Tehlikeli
96.09.16 Jeton ile çalışan kişiselhizmet makinelerinin işletilmesifaaliyetleri (jetonlu makinelerlevesikalık fotoğraf, emanetdolapları, tartı, tansiyon ölçümüvb. hizmetler dahil, oyun ve kumarmakineleri ile çamaşırhanehizmetleri hariç) Az Tehlikeli
96.09.18 Arzuhalcilerinfaaliyetleri Az Tehlikeli
96.09.90 Başka yerde sınıflandırılmamışdiğer hizmet faaliyetleri (dövme vepiercing hizmetleri, vb.) Az Tehlikeli
T HANEHALKLARININ İŞVERENLEROLARAK FAALİYETLERİ; HANEHALKLARITARAFINDAN KENDİ KULLANIMLARINAYÖNELİK OLARAK AYRIM YAPILMAMIŞ MALVE HİZMET ÜRETİM FAALİYETLERİ
97 Ev içi çalışan personelinişverenleri olarak hanehalklarınınfaaliyetleri
97.0 Ev içi çalışan personelinişverenleri olarak hanehalklarınınfaaliyetleri
97.00 Ev içi çalışan personelinişverenleri olarak hanehalklarınınfaaliyetleri
97.00.10 Ev içi çalışan personelinişverenleri olarak hanehalklarınınhizmetleri Az Tehlikeli
98 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamış mal vehizmetler
98.1 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışmallar
98.10 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışmallar
98.10.01 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışmallar Az Tehlikeli
98.2 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışhizmetler
98.20 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışhizmetler
98.20.01 Hanehalkları tarafından kendikullanımlarına yönelik olaraküretilen ayrım yapılmamışhizmetler Az Tehlikeli
U ULUSLARARASI ÖRGÜTLER VETEMSİLCİLİKLERİNİNFAALİYETLERİ
99 Uluslararası örgütler vetemsilciliklerininfaaliyetleri
99.0 Uluslararası örgütler vetemsilciliklerininfaaliyetleri
99.00 Uluslararası örgütler vetemsilciliklerininfaaliyetleri
99.00.15 Uluslararası örgütler vetemsilciliklerinin faaliyetleri(yabancı ülke elçilikleri,milletlerarası işbirliği örgütleri,vb. dahil) Az Tehlikeli
V KENDİ ADINA MENKUL SERMAYEİRADI FAALİYETLERİ (TEMETTÜ, BANKAFAİZİ, İŞTİRAK KAZANÇLARI VB.)
66.13.01 Kendi adına menkul sermayeiradı faaliyetleri (temettü, bankafaizi, iştirak kazançları vb.) Az Tehlikeli